Anti-FKBP23 antibody - C-terminal (ab224349)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to FKBP23 - C-terminal
  • Suitable for: IHC-P, WB, ICC/IF
  • Reacts with: Mouse, Human
  • Isotype: IgG

Overview

  • Product name

    Anti-FKBP23 antibody - C-terminal
    See all FKBP23 primary antibodies

  • Description

    Rabbit polyclonal to FKBP23 - C-terminal

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details

  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human FKBP23 aa 162-259 (C terminal).
    Sequence:

    AEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYL QREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL


    Database link: Q9Y680

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: SH-SY5Y and NIH/3T3 cell lysates. IHC-P: Human small intestine tissue. ICC/IF: A431 cells.

  • General notes

     This product was previously labelled as FKBP7

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab224349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 30 kDa.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    FKBP7 belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. PPIases accelerate the folding of proteins during protein synthesis. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. There are two named isoforms.

  • Cellular localization

    Endoplasmic reticulum lumen.

  • Database links

    see all

  • Alternative names

    • 23 kDa FK506 binding protein antibody
    • 23 kDa FKBP antibody
    • FK506 binding protein 23 antibody
    • FK506 binding protein 7 antibody
    • FK506-binding protein 7 antibody
    • FKBP 23 antibody
    • FKBP 7 antibody
    • FKBP23 antibody
    • Peptidyl prolyl cis trans isomerase FKBP7 antibody
    • PPIase antibody
    • PPIase FKBP7 antibody
    • Rotamase antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-FKBP23 antibody - C-terminal (ab224349)
    Immunocytochemistry/ Immunofluorescence - Anti-FKBP23 antibody - C-terminal (ab224349)

    PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FKBP23 (green) using ab224349 at 4 µg/ml in ICC/IF.

  • Western blot - Anti-FKBP23 antibody - C-terminal (ab224349)
    Western blot - Anti-FKBP23 antibody - C-terminal (ab224349)
    Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution + SH-SY5Y (human neuroblastoma cell line from bone marrow) cell lysate

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FKBP23 antibody - C-terminal (ab224349)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FKBP23 antibody - C-terminal (ab224349)

    Paraffin-embedded human small intestine tissue stained for FKBP23 using ab224349 at 1/50 in immunohistochemical analysis.

  • Western blot - Anti-FKBP23 antibody - C-terminal (ab224349)
    Western blot - Anti-FKBP23 antibody - C-terminal (ab224349)
    All lanes : Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 30 kDa

References (0)

Publishing research using ab224349? Please let us know so that we can cite the reference in this datasheet.

ab224349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab224349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com