Anti-FKBP23 antibody - C-terminal (ab224349)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FKBP23 antibody - C-terminal
See all FKBP23 primary antibodies -
Description
Rabbit polyclonal to FKBP23 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Orangutan -
Immunogen
Recombinant fragment corresponding to Human FKBP23 aa 162-259 (C terminal).
Sequence:AEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYL QREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Database link: Q9Y680 -
Positive control
- WB: SH-SY5Y and NIH/3T3 cell lysates. IHC-P: Human small intestine tissue. ICC/IF: A431 cells.
-
General notes
This product was previously labelled as FKBP7
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224349 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/100 - 1/250. Predicted molecular weight: 30 kDa. | |
ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Relevance
FKBP7 belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. PPIases accelerate the folding of proteins during protein synthesis. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. There are two named isoforms. -
Cellular localization
Endoplasmic reticulum lumen. -
Database links
- Entrez Gene: 51661 Human
- Entrez Gene: 14231 Mouse
- Entrez Gene: 100171639 Orangutan
- Omim: 607062 Human
- SwissProt: Q9Y680 Human
- SwissProt: O54998 Mouse
- SwissProt: Q5RET2 Orangutan
- Unigene: 410378 Human
see all -
Alternative names
- 23 kDa FK506 binding protein antibody
- 23 kDa FKBP antibody
- FK506 binding protein 23 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FKBP23 (green) using ab224349 at 4 µg/ml in ICC/IF.
-
Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution + SH-SY5Y (human neuroblastoma cell line from bone marrow) cell lysate
Developed using the ECL technique.
Predicted band size: 30 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FKBP23 antibody - C-terminal (ab224349)
Paraffin-embedded human small intestine tissue stained for FKBP23 using ab224349 at 1/50 in immunohistochemical analysis.
-
All lanes : Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution
Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
Lane 2 : NBT-II cell lysate
Developed using the ECL technique.
Predicted band size: 30 kDa
Protocols
Datasheets and documents
References
ab224349 has not yet been referenced specifically in any publications.