Overview

  • Product name

    Anti-FKBP23 antibody - C-terminal
    See all FKBP23 primary antibodies
  • Description

    Rabbit polyclonal to FKBP23 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FKBP23 aa 162-259 (C terminal).
    Sequence:

    AEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYL QREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL


    Database link: Q9Y680

  • Positive control

    • WB: SH-SY5Y and NIH/3T3 cell lysates. IHC-P: Human small intestine tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as FKBP7

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 30 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    FKBP7 belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. PPIases accelerate the folding of proteins during protein synthesis. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. There are two named isoforms.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Database links

  • Alternative names

    • 23 kDa FK506 binding protein antibody
    • 23 kDa FKBP antibody
    • FK506 binding protein 23 antibody
    • FK506 binding protein 7 antibody
    • FK506-binding protein 7 antibody
    • FKBP 23 antibody
    • FKBP 7 antibody
    • FKBP23 antibody
    • Peptidyl prolyl cis trans isomerase FKBP7 antibody
    • PPIase antibody
    • PPIase FKBP7 antibody
    • Rotamase antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FKBP23 (green) using ab224349 at 4 µg/ml in ICC/IF.

  • Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution + SH-SY5Y (human neuroblastoma cell line from bone marrow) cell lysate

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Paraffin-embedded human small intestine tissue stained for FKBP23 using ab224349 at 1/50 in immunohistochemical analysis.

  • All lanes : Anti-FKBP23 antibody - C-terminal (ab224349) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 30 kDa

References

ab224349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up