Overview

  • Product name

  • Description

    Rabbit polyclonal to FKBP52
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human FKBP52 aa 2-459. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    TAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGD RVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGE VCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGII RRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLP YGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKS FEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLE YESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSN NEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIR RQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGS QSQVETEA


    Database link: Q02790

  • Positive control

    • WB: Recombinant human FKBP52 protein; K562 cell lysate; Pig brain and kidney lysates. IHC-P: Human stomach, prostate cancer, cerebrum, colorectal cancer, liver and lung cancer tissue.

Applications

Our Abpromise guarantee covers the use of ab232840 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function

    Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unliganded steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 2 PPIase FKBP-type domains.
    Contains 3 TPR repeats.
  • Domain

    The PPIase activity is mainly due to the fisrt PPIase FKBP-type domain (1-138 AA).
    The C-terminal region (AA 375-458) is required to prevent tubulin polymerization.
    The chaperone activity resides in the C-terminal region, mainly between amino acids 264 and 400.
  • Post-translational
    modifications

    Phosphorylation by CK2 results in loss of HSP90 binding activity (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • 51 kDa FK506-binding protein antibody
    • 52 kDa FK506 binding protein antibody
    • 52 kDa FK506-binding protein antibody
    • 52 kDa FKBP antibody
    • 59 kDa immunophilin antibody
    • FK506 binding protein 4 antibody
    • FK506-binding protein 4 antibody
    • FKBP 4 antibody
    • FKBP 52 antibody
    • FKBP 59 antibody
    • FKBP-4 antibody
    • FKBP-52 antibody
    • FKBP4 antibody
    • FKBP4_HUMAN antibody
    • FKBP51 antibody
    • FKBP52 protein antibody
    • FKBP59 antibody
    • HBI antibody
    • Hsp 56 antibody
    • HSP binding immunophilin antibody
    • HSP-binding immunophilin antibody
    • Hsp56 antibody
    • Immunophilin FKBP52 antibody
    • N-terminally processed antibody
    • p52 antibody
    • p59 antibody
    • p59 protein antibody
    • Peptidyl prolyl cis trans isomerase antibody
    • peptidyl-prolyl cis-trans isomerase antibody
    • Peptidyl-prolyl cis-trans isomerase FKBP4 antibody
    • Peptidylprolyl cis trans isomerase antibody
    • PPIase antibody
    • PPIase FKBP4 antibody
    • Rotamase antibody
    • T cell FK506 binding protein 59kD antibody
    see all

Images

  • Anti-FKBP52 antibody (ab232840) at 2 µg/ml + Recombinant human FKBP52 protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 52 kDa

  • All lanes : Anti-FKBP52 antibody (ab232840) at 2 µg/ml

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 2 : Pig brain lysate
    Lane 3 : Pig kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human stomach tissue stained for FKBP52 using ab232840 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for FKBP52 using ab232840 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for FKBP52 using ab232840 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for FKBP52 using ab232840 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for FKBP52 using ab232840 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human lung cancer tissue stained for FKBP52 using ab232840 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232840 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232840.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up