Overview

  • Product name

  • Description

    Rabbit polyclonal to FKBPL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human FKBPL aa 1-349. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE VSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCP DGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGP WREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWE LETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPE RTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG


    Database link: Q9UIM3

  • Positive control

    • IHC-P: Human liver tissue. WB: HL-60 and HeLa cell lysates; Mouse testis lysate; Recombinant human FKBPL protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Function

    May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.
  • Tissue specificity

    Ubiquitously expressed with higher levels in testis.
  • Sequence similarities

    Contains 3 TPR repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • DIR1 antibody
    • FK506 binding protein like antibody
    • FK506-binding protein-like antibody
    • Fkbpl antibody
    • FKBPL_HUMAN antibody
    • NG7 antibody
    • OTTHUMP00000029170 antibody
    • WAF 1/CIP1 stabilizing protein 39 antibody
    • WAF-1/CIP1 stabilizing protein 39 antibody
    • WISP39 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for FKBPL using ab233409 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-FKBPL antibody (ab233409) at 2 µg/ml + Recombinant human FKBPL protein

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233409) at 2 µg/ml + HL-60 (Human promyelocytic leukemia cell line) cell lysate

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233409) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233409) at 2 µg/ml + Mouse testis tissue lysate

    Predicted band size: 38 kDa

References

ab233409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up