Overview

  • Product name

  • Description

    Rabbit polyclonal to FKBPL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse FKBPL aa 1-347. N-terminal His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    METSPISPMNEKNTAQPQQREENAQQILNTAIPFRQRSPGLLPEALKVGV RPDPANQIVETQEIEHPVAGFEGDSDQFQVSTNEMAEHLQASDLWYCPDG SFVKKIIVPGHGLDKPKLGSKCQVLALGFPFGSGMPEGWTELTIGIGQWR EKMWGELMEKCLESMRQGEEAKIHLPGSSAPLAKLRLDSFTNGRDSWEME AMEKEALAKEEHRRGTELFRAGNPQGAARCYGRALRLLLTLPPPGPPERT TLYANLAACQLLLGHPQLAAQSCDRVLEREPGHLKALYRRGVARAALGDL EKATADFKKVLAVDPKNRAAKEELGKVVIQGRKQDAGLARGLRKMFS


    Database link: O35450

  • Positive control

    • IHC-P: Mouse testis tissue. WB: MCF7, HEK-293T and Jurkat cell lysates; Recombinant mouse FKBPL protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 38 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for FKBPL using ab233426 at 20 µg/ml in immunoistochemical analysis. DAB staining.

  • Anti-FKBPL antibody (ab233426) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233426) at 2 µg/ml + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233426) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 38 kDa

  • Anti-FKBPL antibody (ab233426) at 2 µg/ml + Recombinant mouse FKBPL protein

    Predicted band size: 38 kDa

References

ab233426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up