Overview

  • Product name

  • Description

    Rabbit polyclonal to FKSG14/p33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FKSG14/p33 aa 1-269.
    Sequence:

    MNQEDLDPDSTTDVGDVTNTEEELIRECEEMWKDMEECQNKLSLIGTETL TDSNAQLSLLIMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKL RQDLEMVLSTKESKNEKLKEDLEREQRWLDEQQQIMESLNVLHSELKNKV ETFSESRIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKK NIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNG IALRHPEDPTRIRLEAFHQ


    Database link: Q9BS16

  • Positive control

    • WB: PC-3 and HEK-293T whole cell lysates. IHC-P: Human skin and liver tissue.
  • General notes

    Previously labelled as FKSG14. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 32 kDa.

Target

  • Relevance

    FKSG14 / p33, also known as CENPK (centromere protein K) is a component of the CENPA-CAD (nucleosome distal) complex. It may be involved in incorporation of CENPA into centromeres and is required for proper kinetochore function, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex. Acts in coordination with CASC5/KNL1 to recruit the NDC80 complex to the outer kinetochore. FKSG14 / p33 constitutively localized to centromeres throughout the cell cycle. There are 3 isoforms produced by alternative splicing.
  • Cellular localization

    Nuclear. Centromere. Kinetochore. Localizes exclusively in the centromeres.
  • Database links

  • Alternative names

    • AF5 alpha antibody
    • AF5alpha antibody
    • B130045K24Rik antibody
    • BB232189 antibody
    • C530004N04Rik antibody
    • CENP K antibody
    • CENPK antibody
    • Centromere protein K antibody
    • Centromeric protein K antibody
    • FKSG 14 antibody
    • FKSG14 antibody
    • ICEN 37 antibody
    • ICEN37 antibody
    • Interphase centromere complex protein 37 antibody
    • Leucine zipper protein FKSG14 antibody
    • OTTHUMP00000161888 antibody
    • P33 antibody
    • Protein AF 5alpha antibody
    • Protein AF5alpha antibody
    • Solt antibody
    • Solzt antibody
    • SoxLZ/Sox6 binding protein Solt antibody
    • SoxLZ/Sox6 leucine zipper binding protein antibody
    see all

Images

  • All lanes : Anti-FKSG14/p33 antibody (ab236739) at 1/1000 dilution

    Lane 1 : PC-3 (Human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 32 kDa

  • Paraffin-embedded human skin tissue stained for FKSG14/p33 using ab236739 at 1/100 dilution in immunohistochemical analysis.

  • Immunoprecipitating FKSG14/p33 in Hela whole cell lysate
    Lane 1: Rabbit control IgG instead of ab236739 in Hela whole cell lysate. For western blotting, a HRP-conjugated Protein G antibody was used as the secondary antibody (1/2000)
    Lane 2: ab236739 (8μg) + Hela whole cell lysate (500μg)
    Lane 3: HeLa whole cell lysate (10μg)

  • Paraffin-embedded human liver tissue stained for FKSG14/p33 using ab236739 at 1/100 dilution in immunohistochemical analysis.

References

ab236739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up