Overview

  • Product name

    Anti-Flagellin antibody (Biotin)
    See all Flagellin primary antibodies
  • Description

    Rabbit polyclonal to Flagellin (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: ELISAmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli Flagellin aa 2-498.
    Sequence:

    AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIA NRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATT GTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGAN DNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLT GITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVA NDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGA VSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSG AASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTA VANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSE AQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG


    Database link: P04949

Properties

Applications

Our Abpromise guarantee covers the use of ab193301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    Flagellin (FliC) is a subunit protein that polymerizes (along with other proteins) to form the filaments of bacterial flagella. Assembly of the bacterial flagellum occurs in a precise, temporal order where the basal component (FlgE, FlgK, and FlgL are assembled inside the bacterial membrane, followed by exportation of the filament cap protein FliD, and secretion of about 20,000 flagellin monomers (FliC) through the channel. FliC monomers are polymerized to form the tail filament. FliC monomers can function as pathogen-associated molecular patterns (PAMPs), and can be detected by host cells through surface-localized toll-like receptor 5 (TLR5) and cytosolic Nod-like receptors (NLRs).
  • Cellular localization

    Secreted. Bacterial flagellum.
  • Database links

    • Alternative names

      • 41 kDa antigen antibody
      • b1923 antibody
      • flaF antibody
      • Flagellar filament 41 kDa core protein antibody
      • Flagellin antibody
      • fliC antibody
      • hag antibody
      • JW1908 antibody
      • P41 antibody
      see all

    References

    ab193301 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193301.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up