Overview

  • Product name

    Anti-Flavivirus E-glycoprotein antibody [HF5-3/D5-3/B10-2]
    See all Flavivirus E-glycoprotein primary antibodies
  • Description

    Mouse monoclonal [HF5-3/D5-3/B10-2] to Flavivirus E-glycoprotein
  • Host species

    Mouse
  • Specificity

    This monoclonal antibody reacts with a conformational epitope present in DENV1, 2, 3, 4, ZIKV, JEV and WNV.
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Dengue virus 1, Dengue virus 2, Dengue virus 3, Dengue virus 4, Japanese encephalitis virus, Zika virus
  • Immunogen

    Recombinant full length protein corresponding to Dengue Virus 1 Flavivirus E-glycoprotein aa 281-775.
    Sequence:

    MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKNKPTLDIELLKTEV TNPAVLRKLC IEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVD RGWGNGCGLFGKGSLLTCAKFK CVTKLEGKIVQYENLKYSVIVTVHTG DQHQVGNETTEHGTIATITPQAPTSEIQLTDYGA LTLDCSPRTGLDFN EMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTF KT AHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKL TLKGTSYV MCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQ DEKGVTQNGRLITANPIVTD KEKPVNIETEPPFGESYIVVGAGEKALK LSWFKKGSSIGKMFEATARGARRMAILGDTAW DFGSIGGVFTSVGKLV HQVFGTAYGVLFSGVSWTMKIGIGILLTWLGLNSRSTSLSMTCI AVGM VTLYLGVMVQA


    Database link: P27909

  • Positive control

    • WB: DENV1 (Hawaii), DENV2 (NGC), DENV3 (H89), DENV4 (H241), ZIKV (Cambodia), JEV (Nakayama) infected C6/36 cell lysates; ICC/IF: DENV1, DENV2, DENV3, DENV4 and ZIKV infected cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Proclin
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    HF5-3/D5-3/B10-2
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Relevance

    The Flaviviridae are a family of viruses that are primarily spread through arthropod vectors (mainly ticks and mosquitoes). Flaviviridae have monopartite, linear, single-stranded RNA genomes of positive polarity, 9.6- to 12.3-kilobase in length with enveloped and spherical virus particles, about 40-60 nm in diameter.
  • Database links

    • Alternative names

      • Flavivirus envelope glycoprotein antibody

    Images

    • Immunofluorescent analysis of DENV3, DENV4 and ZIKV infected cells labeling Flavivirus E-glycoprotein using ab214330 or an ontibody control.

    • Immunofluorescent analysis of DENV1 and DENV2 infected cells and not infected cells labeling Flavivirus E-glycoprotein using ab214330 or an ontibody control.

    • All lanes : Anti-Flavivirus E-glycoprotein antibody [HF5-3/D5-3/B10-2] (ab214330)

      Lane 1 : DENV1 (Hawaii) infected C6/36 cell lysate
      Lane 2 : DENV2 (NGC) infected C6/36 cell lysate
      Lane 3 : DENV3 (H89) infected C6/36 cell lysate
      Lane 4 : DENV4 (H241) infected C6/36 cell lysate
      Lane 5 : ZIKV (Cambodia) infected C6/36 cell lysate
      Lane 6 : JEV (Nakayama) infected C6/36 cell lysate
      Lane 7 : YFV (17D) infected C6/36 cell lysate
      Lane 8 : WNV (E101) infected C6/36 cell lysate
      Lane 9 : uninfected C6/36 cell lysate (control)

    References

    ab214330 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab214330.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up