Overview

  • Product name

    Anti-Flavivirus E-glycoprotein antibody [HF8-1/C1-5/6/D2]
    See all Flavivirus E-glycoprotein primary antibodies
  • Description

    Mouse monoclonal [HF8-1/C1-5/6/D2] to Flavivirus E-glycoprotein
  • Host species

    Mouse
  • Specificity

    This monoclonal antibody reacts with a conformational epitope present in DENV1, 2, 3, 4, ZIKV, JEV and WNV.
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Dengue virus 1, Dengue virus 2, Dengue virus 3, Dengue virus 4, Japanese encephalitis virus, West Nile virus, Zika virus
  • Immunogen

    Recombinant full length protein corresponding to Dengue Virus 1 Flavivirus E-glycoprotein aa 281-775.
    Sequence:

    MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKNKPTLDIELLKTEV TNPAVLRKLC IEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVD RGWGNGCGLFGKGSLLTCAKFK CVTKLEGKIVQYENLKYSVIVTVHTG DQHQVGNETTEHGTIATITPQAPTSEIQLTDYGA LTLDCSPRTGLDFN EMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTF KT AHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKL TLKGTSYV MCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQ DEKGVTQNGRLITANPIVTD KEKPVNIETEPPFGESYIVVGAGEKALK LSWFKKGSSIGKMFEATARGARRMAILGDTAW DFGSIGGVFTSVGKLV HQVFGTAYGVLFSGVSWTMKIGIGILLTWLGLNSRSTSLSMTCI AVGM VTLYLGVMVQA


    Database link: P27909

  • Positive control

    • WB: DENV1 (Hawaii), DENV2 (NGC), DENV3 (H89), DENV4 (H241), ZIKV (Cambodia), JEV (Nakayama), WNV (E101) infected C6/36 cell lysates; ICC/IF: DENV1, DENV2, DENV3, DENV4 and ZIKV infected cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Proclin
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    HF8-1/C1-5/6/D2
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

Images

  • Immunofluorescent analysis of DENV3, DENV4 and ZIKV infected cells labeling Flavivirus E-glycoprotein using ab214331 or an antibody control.

  • Immunofluorescent analysis of DENV1, DENV2 infected cells and uninfected cells labeling Flavivirus E-glycoprotein using ab214331 or an antibody control.

  • All lanes : Anti-Flavivirus E-glycoprotein antibody [HF8-1/C1-5/6/D2] (ab214331)

    Lane 1 : DENV1 (Hawaii) infected C6/36 cell lysate
    Lane 2 : DENV2 (NGC) infected C6/36 cell lysate
    Lane 3 : DENV3 (H89) infected C6/36 cell lysate
    Lane 4 : DENV4 (H241) infected C6/36 cell lysate
    Lane 5 : ZIKV (Cambodia) infected C6/36 cell lysate
    Lane 6 : JEV (Nakayama) infected C6/36 cell lysate
    Lane 7 : YFV (17D) infected C6/36 cell lysate
    Lane 8 : WNV (E101) infected C6/36 cell lysate
    Lane 9 : C6/36 cell lysate control (uninfected)

References

ab214331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up