Overview

  • Product name

    Anti-Flavivirus E-glycoprotein antibody [HF8-3/D5-10/6/A6]
    See all Flavivirus E-glycoprotein primary antibodies
  • Description

    Mouse monoclonal [HF8-3/D5-10/6/A6] to Flavivirus E-glycoprotein
  • Host species

    Mouse
  • Specificity

    ab214336 reacts with a conformational epitope present in DENV1, 2, 3, 4, ZIKV, JEV and WNV.
  • Tested applications

    Suitable for: Sandwich ELISA, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Dengue virus 1, Dengue virus 2, Dengue virus 3, Dengue virus 4, Japanese encephalitis virus, West Nile virus, Zika virus
  • Immunogen

    Recombinant full length protein corresponding to Dengue Virus 1 Flavivirus E-glycoprotein aa 281-775.
    Sequence:

    MRCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKNKPTLDIELLKTEV TNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDANFVCRRTFVDRG WGNGCGLFGKGSLLTCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGDQHQ VGNETTEHGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLT MKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEV VVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGTSYV MCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQNGR LITANPIVTDKEKPVNIETEPPFGESYIVVGAGEKALKLSWFKKGSSIGK MFEATARGARRMAILGDTAWDFGSIGGVFTSVGKLVHQVFGTAYGVLFSG VSWTMKIGIGILLTWLGLNSRSTSLSMTCI


    Database link: P27909

  • Positive control

    • Sandwich ELISA: Zika infected C6/36 cells; WB: DENV1 (Hawaii), DENV2 (NGC), DENV3 (H89), DENV4 (H241), ZIKV (Cambodia), JEV (Nakayama), WNV (E101) infected C6/36 cell lysates; ICC/IF: DENV1, DENV2, DENV3, DENV4, ZIKV infected cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Proclin
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Clone number

    HF8-3/D5-10/6/A6
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Sandwich ELISA Use at an assay dependent concentration.

Primarily used for the capture/detection of DENV1, 2, 3, 4, ZIKV, JEV and WNV antigens in an antigen capture ELISA.

WB Use at an assay dependent concentration.

Detects DENV1, 2, 3, 4, ZIKV, JEV and WNV by western blot (non-reducing conditions).

ICC/IF Use at an assay dependent concentration.

Detects DENV1, 2, 3, 4 and ZIKV in immunofluorescence. Not tested in FRNT. Can neutralize ZIKV in a standard VERO PRNT. Not tested against DENV, JEV and WNV by PRNT.

Target

Images

  • Sandwich ELISA detection Flavivirus E-glycoprotein in Zika infected and non infected C6/36 cells using ab214336 and other anti Flavivirus E-glycoprotein antibodies as capture antibody. 

  • All lanes : Anti-Flavivirus E-glycoprotein antibody [HF8-3/D5-10/6/A6] (ab214336)

    Lane 1 : DENV1 (Hawaii) infected C6/36 cell lysate
    Lane 2 : DENV2 (NGC) infected C6/36 cell lysate
    Lane 3 : DENV3 (H89) infected C6/36 cell lysate
    Lane 4 : DENV4 (H241) infected C6/36 cell lysate
    Lane 5 : ZIKV (Cambodia) infected C6/36 cell lysate
    Lane 6 : JEV (Nakayama) infected C6/36 cell lysate
    Lane 7 : YFV (17D) infected C6/36 cell lysate
    Lane 8 : WNV (E101) infected C6/36 cell lysate
    Lane 9 : uninfected C6/36 cell lysate control
  • Immunofluorescent analysis of DENV1, DENV2, DENV3, DENV4 and ZIKV infected cells labeling Flavivirus E-glycoprotein using ab214336.

References

ab214336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up