Overview

  • Product name

    Anti-Flightless I antibody
    See all Flightless I primary antibodies
  • Description

    Rabbit polyclonal to Flightless I
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Flightless I aa 896-1176. Two N-terminal Tags. Expressed in E.coli.
    Sequence:

    LMEEWNEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVE YEEEEKKEDKEEKAEGKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNM GWLTFTFSLQKKFESLFPGKLEVVRMTQQQENPKFLSHFKRKFIIHRGKR KAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLLNSEFCFILKVPFESE DNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEPENFFW VGIGAQKPYDDDAEYMKHTRLFRCSNEKGYF


    Database link: Q13045-1

  • Positive control

    • WB: Recombinant human Flightless I protein; Pig kidney lysate; Human lung lysate. IHC-P: Human skeletal muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling. Involved in early embryonic development (By similarity). May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration.
  • Tissue specificity

    Strongest expression in skeletal muscle with high expression also in the heart and lung.
  • Involvement in disease

    Deletion of the FLII gene may be a cause of Smith-Magenis syndrome (SMS) [MIM:182290]. It is a contiguous gene deletion syndrome involving developmental abnormalities and mental retardation. The spectrum of clinical findings includes short stature, brachydactyly, developmental delay, dysmorphic features, sleep disturbances, and behavioral problems.
  • Sequence similarities

    Contains 5 gelsolin-like repeats.
    Contains 15 LRR (leucine-rich) repeats.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Colocalizes to actin-rich structures in blastocysts and, together with HRAS1, RHOA and CDC42, in migrating fibroblasts. Localizes to centrosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fli 1 antibody
    • FLI antibody
    • Fli1 antibody
    • Flightless 1 antibody
    • Flightless I (Drosophila) homolog antibody
    • Flightless I homolog antibody
    • Flightless I homolog (Drosophila) antibody
    • Flightless1 antibody
    • FlightlessI antibody
    • fliI antibody
    • FLII_HUMAN antibody
    • Fliih antibody
    • FLIL antibody
    • MGC39265 antibody
    • Protein flightless 1 homolog antibody
    • Protein flightless-1 homolog antibody
    see all

Images

  • All lanes : Anti-Flightless I antibody (ab233001) at 2 µg/ml

    Lane 1 : Human lung tissue lysate.
    Lane 2 : Pig kidney tissue lysate.

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human skeletal muscle tissue stained for Flightless I using ab233001 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Flightless I antibody (ab233001) at 2 µg/ml + Recombinant human Flightless I protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

References

ab233001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up