Overview

  • Product name

  • Description

    Rabbit polyclonal to FLIP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat FLIP aa 43-281. (Expressed in E.coli).
    Sequence:

    RDLLDCLSERGQLSFAALAELLYRVRRFDLLKRILKTDKAAVEDHLCRSP HLVSDYRVLLMEIGENLNQSDVSSLIFLTKDYTGRGKVAKDKSFLDLVIE LEKLNLIGSDQLNLLEKCLKSIHRIDLKTKIQKYTQSSQEARSNMNALQA SLPKLSIKEHLYNSRLQNGRSKEPRFVEHHGIQRKPVKTSIQESGIFLPP HIHEESYRMQSKPLGICLIIDCIGNDTEYLRETFTSLGY


    Database link: C0H5Y5

  • Positive control

    • WB: Recombinant rat FLIP protein; Jurkat, HeLa and K562 cell lysates; Rat spleen lysate. IHC-P: Rat liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 55 kDa.

Target

  • Function

    Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.
  • Tissue specificity

    Widely expressed. Higher expression in skeletal muscle, pancreas, heart, kidney, placenta, and peripheral blood leukocytes. Also detected in diverse cell lines. Isoform 8 is predominantly expressed in testis and skeletal muscle.
  • Sequence similarities

    Belongs to the peptidase C14A family.
    Contains 2 DED (death effector) domains.
  • Domain

    The caspase domain lacks the active sites residues involved in catalysis.
  • Post-translational
    modifications

    Proteolytically processed; probably by caspase-8. Processing likely occurs at the DISC and generates subunit p43 and p12.
  • Information by UniProt
  • Database links

  • Alternative names

    • c FLIP antibody
    • c FLIPL antibody
    • c FLIPR antibody
    • c FLIPS antibody
    • c-FLIP antibody
    • c-FLIPL antibody
    • c-FLIPR antibody
    • c-FLIPS antibody
    • CASH antibody
    • CASP8 and FADD like apoptosis regulator antibody
    • CASP8 and FADD-like apoptosis regulator subunit p12 antibody
    • CASP8AP1 antibody
    • Caspase homolog antibody
    • Caspase like apoptosis regulatory protein antibody
    • Caspase related inducer of apoptosis antibody
    • Caspase-eight-related protein antibody
    • Caspase-like apoptosis regulatory protein antibody
    • Casper antibody
    • cellular flice inhibitory protein antibody
    • Cellular FLICE-like inhibitory protein antibody
    • CFLA antibody
    • Cflar antibody
    • CFLAR_HUMAN antibody
    • CLARP antibody
    • FADD like anti apoptotic molecule antibody
    • FADD-like antiapoptotic molecule 1 antibody
    • FLAME antibody
    • FLAME-1 antibody
    • FLAME1 antibody
    • FLIP antibody
    • I FLICE antibody
    • I-FLICE antibody
    • Inhibitor of FLICE antibody
    • MACH-related inducer of toxicity antibody
    • MRIT antibody
    • OTTHUMP00000163715 antibody
    • OTTHUMP00000206475 antibody
    • OTTHUMP00000206476 antibody
    • OTTHUMP00000206478 antibody
    • OTTHUMP00000206479 antibody
    • OTTHUMP00000206480 antibody
    • OTTHUMP00000206482 antibody
    • OTTHUMP00000207360 antibody
    • Usurpin antibody
    • Usurpin beta antibody
    see all

Images

  • Paraffin-embedded rat liver tissue stained for FLIP using ab233230 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-FLIP antibody (ab233230) at 3 µg/ml + Recombinant rat FLIP protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

  • All lanes : Anti-FLIP antibody (ab233230) at 3 µg/ml

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 4 : Rat spleen lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 55 kDa

References

ab233230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up