Overview

  • Product name

    Anti-FLJ26957 antibody
  • Description

    Rabbit polyclonal to FLJ26957
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FLJ26957 aa 3-77.
    Sequence:

    TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLR PKRSPPVISEEAAEDVKQYLTISEH


    Database link: Q6ZNX1

  • Positive control

    • ICC/IF: SK-MEL-30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab221717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Images

  • PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells stained for C5ORF44 (green) using ab221717 at 4 µg/ml in ICC/IF.

References

ab221717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Human Cell lysate - whole cell (Human protein complemented into mouse cells)
Gel Running Conditions
Reduced Denaturing (NuPage 4-12%)
Loading amount
15 µg
Specification
Human protein complemented into mouse cells
Blocking step
5% milk in 0.1% PBS-Tween as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted May 02 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up