Overview

  • Product name

    Anti-FLJ30934 antibody
  • Description

    Rabbit polyclonal to FLJ30934
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human FLJ30934 aa 144-403.
    Sequence:

    RLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEAL ITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYI PISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDML RYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQL CCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILR NTLVALKGEP


    Database link: Q86XE0

  • Positive control

    • WB: Mouse brain, liver, stomach, lung and kidney tissue lysates; Rat brain tissue lysate. IHC-P: Human adrenal gland and thymus tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 46 kDa (predicted molecular weight: 46 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-FLJ30934 antibody (ab230112) at 1/1000 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Rat brain tissue lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : Mouse stomach tissue lysate
    Lane 5 : Mouse lung tissue lysate
    Lane 6 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 46 kDa
    Observed band size: 46 kDa

  • Paraffin-embedded human adrenal gland tissue stained for FLJ30934 using ab230112 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thymus tissue stained for FLJ30934 using ab230112 at 1/100 dilution in immunohistochemical analysis.

References

ab230112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up