Overview

  • Product name

  • Description

    Rabbit polyclonal to FLRT3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FLRT3 aa 209-264.
    Sequence:

    NLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNH INRVPP


    Database link: Q9NZU0

  • Positive control

    • WB: Mouse heart, liver, brain and skeletal muscle lysates. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 73 kDa (predicted molecular weight: 73 kDa).
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-FLRT3 antibody (ab223047) at 1/1000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : Mouse skeletal muscle lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 73 kDa
    Observed band size: 73 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FLRT3 (green) using ab223047 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab223047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up