Overview

  • Product name

    Anti-Flt3 ligand/Flt3L antibody
    See all Flt3 ligand/Flt3L primary antibodies
  • Description

    Rabbit polyclonal to Flt3 ligand/Flt3L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Flt3 ligand/Flt3L aa 27-184.
    Sequence:

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTAPQP


    Database link: P49771

  • Positive control

    • ICC/IF: MCF7 cells. IHC-P: Human tonsil tissue.
  • General notes

    Previously labelled as Flt3 ligand.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FL antibody
    • Flt 3 ligand antibody
    • Flt 3L antibody
    • Flt3 L antibody
    • FLT3 LG antibody
    • Flt3 ligand antibody
    • Flt3L antibody
    • FLT3L_HUMAN antibody
    • Flt3lg antibody
    • Fms related tyrosine kinase 3 ligand antibody
    • Fms-related tyrosine kinase 3 ligand antibody
    • SL cytokine antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells stained for Flt3 ligand/Flt3L (Green) using ab238610 at 1/266 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

  • Paraffin-embedded human tonsil tissue stained for Flt3 ligand/Flt3L using ab238610 at 1/100 dilution in immunohistochemical analysis.

References

ab238610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up