Overview

  • Product name

    Anti-Flt3 ligand/Flt3L antibody
    See all Flt3 ligand/Flt3L primary antibodies
  • Description

    Rabbit polyclonal to Flt3 ligand/Flt3L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Neutralising, Flow Cyt, Sandwich ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Flt3 ligand/Flt3L aa 27-181. Highly pure>98%. Produced in E. coli.
    Sequence:

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRL VLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTN ISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEA TAPTA


    Database link: P49771

  • Positive control

    • Recombinant human Flt3 ligand/Flt3L protein (ab9690) can be used as a positive control in WB. Flow Cytometry: Human Flt3 ligand/Flt3L-transfected mouse OP9 cell line.
  • General notes

    hflt3-Ligand (flk2-ligand) stimulates the proliferation and colony formation of certain bone marrow precursor cells including CD34+ cells

    Previously labelled as Flt3 ligand.

Properties

  • Form

    Lyophilised:Reconstitute with 200µl of sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    PBS, pH 7.4, no preservative, sterile filtered
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Primary antibody notes

    hflt3-Ligand (flk2-ligand) stimulates the proliferation and colony formation of certain bone marrow precursor cells including CD34+ cells
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab9688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml.

The detection limit for recombinant Flt3 ligand/Flt3L is 1.5-3.0 ng/lane, under either reducing or non-reducing conditions.

Neutralising Use a concentration of 0.004 - 0.006 µg/ml. Yields one-half maximal inhibition [ND50] of the biological activity of hFlt-3 Ligand (1.0 ng/ml)
Flow Cyt Use at an assay dependent concentration. PubMed: 22897934
Sandwich ELISA Use a concentration of 0.5 - 2 µg/ml.

In conjunction with ab84261 rabbit polyclonal to Flt3 ligand/Flt3L (Biotin) as a detection antibody, allows the detection of at least 0.2 - 0.4 ng/well of recombinant human Flt3 ligand/Flt3L.

Target

  • Function

    Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FL antibody
    • Flt 3 ligand antibody
    • Flt 3L antibody
    • Flt3 L antibody
    • FLT3 LG antibody
    • Flt3 ligand antibody
    • Flt3L antibody
    • FLT3L_HUMAN antibody
    • Flt3lg antibody
    • Fms related tyrosine kinase 3 ligand antibody
    • Fms-related tyrosine kinase 3 ligand antibody
    • SL cytokine antibody
    see all

Images

  • Flow cytometry analysis of human Flt3 ligand/Flt3L-transfected mouse OP9 cell line, staining Flt3 ligand/Flt3L with ab9688. The primary antibody was conjugated to AlexaFluor®488 before incubation with paraformaldehyde-fixed, serum-blocked cells.

  • Sandwich ELISA - Anti-Flt3 ligand/Flt3L antibody (ab9688).

References

This product has been referenced in:

  • Yuan X  et al. Mesenchymal stem cell therapy induces FLT3L and CD1c+ dendritic cells in systemic lupus erythematosus patients. Nat Commun 10:2498 (2019). Read more (PubMed: 31175312) »
  • Barry KC  et al. A natural killer-dendritic cell axis defines checkpoint therapy-responsive tumor microenvironments. Nat Med 24:1178-1191 (2018). Read more (PubMed: 29942093) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up