Overview

  • Product name

  • Description

    Rabbit polyclonal to FLVCR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide corresponding to Mouse FLVCR1 aa 223-272 (internal sequence).
    Sequence:

    GPKEVSTACATAVLGNQLGTAVGFLLPPVLVPALGTQNSTGLLAHTQNNT


    Database link: NP_001074728

  • Positive control

    • Mouse brain lysate.
  • General notes

     This product was previously labelled as FLVCR

     

Properties

Applications

Our Abpromise guarantee covers the use of ab115865 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Heme transporter that exports cytoplasmic heme. It can also export coproporphyrin and protoporphyrin IX, which are both intermediate products in the heme biosynthetic pathway. Does not export bilirubin. Heme export depends on the presence of HPX and may be required to protect developing erythroid cells from heme toxicity. Heme export also provides protection from heme or ferrous iron toxicities in liver and brain. Causes susceptibility to FeLV-C in vitro.
  • Tissue specificity

    Found all hematopoietic tissues including peripheral blood lymphocytes. Some expression is found in pancreas and kidney.
  • Involvement in disease

    Defects in FLVCR1 are the cause of posterior column ataxia with retinitis pigmentosa (PCARP) [MIM:609033]. A neurodegenerative syndrome beginning in infancy with areflexia and retinitis pigmentosa. Nyctalopia (night blindness) and peripheral visual field loss are usually evident during late childhood or teenage years, with subsequent progressive constriction of the visual fields and loss of central retinal function over time. A sensory ataxia caused by degeneration of the posterior columns of the spinal cord results in a loss of proprioceptive sensation that is clinically evident in the second decade of life and gradually progresses. Scoliosis, camptodactyly, achalasia, gastrointestinal dysmotility, and a sensory peripheral neuropathy are variable features of the disease. Affected individuals have no clinical or radiological evidence of cerebral or cerebellar involvement. Note=Defective neuronal heme transmembrane export due to FLVCR1 mutations may abrogate the neuroprotective effects of neuroglobin and initiate an apoptotic cascade that results in the selective degeneration of photoreceptors in the neurosensory retina and sensory neurons in the posterior spinal cord.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Feline leukemia virus subgroup C receptor (TC 2.A.1.28.1) family.
  • Developmental stage

    Down-regulated in haemopoietic progenitor cells undergoing differentiation and hemoglobinization. Abundant in fetal liver.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Feline leukemia virus subgroup C cellular receptor antibody
    • Feline leukemia virus subgroup C receptor antibody
    • Feline leukemia virus subgroup C receptor related protein 1 antibody
    • Feline leukemia virus subgroup C receptor-related protein 1 antibody
    • FLVC1_HUMAN antibody
    • FLVCR 1 antibody
    • FLVCR protein antibody
    • FLVCR1 antibody
    • hFLVCR antibody
    see all

Images

  • Anti-FLVCR1 antibody (ab115865) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size: 60 kDa



    Gel concentration: 12%

References

ab115865 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Kidney)
Permeabilization
Yes - TritonX-100 .1%
Specification
Kidney
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 4% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Oct 08 2018

Answer

Thank you for your enquiry regardingab115865 and for taking the time to provide some useful details of the experiments. I am very sorry to hear that you are having problems with this antibody.

I would like to reassure you that our Abpromise applies to your complaint since you purchased this product within the guarantee period. This means that in the event that a product is not functioning in the applications/species cited on the product data sheet (and the problem has been reported within 6 months of purchase) we will happily offer a credit note/refund to the value of the product purchased.

It would be much appreciated if I could get some more information which would help me identify the source of the problem.



1) Transfection:

- Does the construct contain full sequence or fragment of the target protein (mouse FLVCR)?



2) Tagging:

As you may aware, tag itself may obscure native interactions and inhibit the binding of the antibody to the target due to 3-D sterical hindrance.

- Where is the location of the tag within the reading frame of the FLVCR protein?

- How many copies of tags have been inserted?



3) Positive control:

Have you applied mouse brain lysate as recommended positive control?



4) Secondary antibody:

- Does the detection system work fine? Have you used it successfully with another primary antibody?

- Have you run a no primary - only secondary antibody - control to see if any of the non-specific bands are due to the secondary or not?

Thank you for your understanding and co-operation in this matter. I look forward to hearing from you and hope to solve this problem as soon as possible.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up