Overview

  • Product name

  • Description

    Rabbit polyclonal to FMNL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FMNL1 aa 880-991.
    Sequence:

    LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELT QREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPK TTSPGLFFSLFS


    Database link: O95466

  • Positive control

    • WB: MOLT-4 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 122 kDa.

Target

  • Function

    May play a role in the control of cell motility and survival of macrophages (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the formin homology family.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Domain

    The DAD domain regulates activation via by an autoinhibitory interaction with the N-terminus. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments.
  • Post-translational
    modifications

    Myristoylation mediates membrane localization and blebbing.
  • Cellular localization

    Cytoplasm > cell cortex. Cell projection > bleb. Colocalized with F-actin in bleb protrusions and Cytoplasm. Cell membrane. Cytoplasmic vesicle > phagosome. Recruited to actin-rich phagosomes during phagocytosis. Translocates to the plasma membrane upon activation by RAC1.
  • Information by UniProt
  • Database links

  • Alternative names

    • 8030453N10Rik antibody
    • AI553564 antibody
    • C17orf1 antibody
    • C17orf1B antibody
    • CLL associated antigen KW 13 antibody
    • CLL-associated antigen KW-13 antibody
    • FHOD4 antibody
    • FMNL antibody
    • FMNL_HUMAN antibody
    • Fmnl1 antibody
    • Fnrl antibody
    • Formin like 1 antibody
    • Formin like antibody
    • Formin related protein antibody
    • Formin-like protein 1 antibody
    • Frls antibody
    • KW 13 antibody
    • KW13 antibody
    • Leukocyte formin antibody
    • MGC133052 antibody
    • MGC1894 antibody
    • MGC21878 antibody
    see all

Images

  • Anti-FMNL1 antibody (ab224247) at 1/100 dilution + MOLT-4 (human lymphoblastic leukemia cell line) cell lysate

    Predicted band size: 122 kDa

  • PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for FMNL1 (green) using ab224247 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human lung tissue stained for FMNL1 with ab224247 (1/50 dilution) in immunohistochemical analysis.

References

ab224247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up