Overview

  • Product name

  • Description

    Rabbit polyclonal to FMO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FMO1 aa 247-348.
    Sequence:

    LPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGK VFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVE DG


    Database link: Q01740

  • Positive control

    • IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
  • Tissue specificity

    Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.
  • Sequence similarities

    Belongs to the FMO family.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dimethylaniline monooxygenase [N oxide forming] 1 antibody
    • Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody
    • Dimethylaniline oxidase 1 antibody
    • Fetal hepatic flavin containing monooxygenase 1 antibody
    • Fetal hepatic flavin-containing monooxygenase 1 antibody
    • Flavin containing monooxygenase 1 (fetal liver) antibody
    • Flavin Containing Monooxygenase 1 antibody
    • FMO 1 antibody
    • FMO1 antibody
    • FMO1_HUMAN antibody
    • OTTHUMP00000033536 antibody
    • OTTHUMP00000033537 antibody
    see all

Images

  • Paraffin embedded human kidney tissue stained for FMO1 with ab224452 (1/200 dilution) in immunohistochemical analysis.

References

ab224452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up