Overview

  • Product name

  • Description

    Rabbit polyclonal to FMO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FMO2 aa 210-471.
    Sequence:

    VFISTRHGTWVMSRISEDGYPWDSVFHTRFRSMLRNVLPRTAVKWMIEQQ MNRWFNHENYGLEPQNKYIMKEPVLNDDVPSRLLCGAIKVKSTVKELTET SAIFEDGTVEENIDVIIFATGYSFSFPFLEDSLVKVENNMVSLYKYIFPA HLDKSTLACIGLIQPLGSIFPTAELQARWVTRVFKGLCSLPSERTMMMDI IKRNEKRIDLFGESQSQTLQTNYVDYLDELALEIGAKPDFCSLLFKDPKL AVRLYFGPCNSY


    Database link: Q99518

  • Positive control

    • IHC-P: Human lung cancer and ovarian cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab234775 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.
  • Tissue specificity

    Expressed in lung (at protein level). Expressed predominantly in lung, and at a much lesser extent in kidney. Also expressed in fetal lung, but not in liver, kidney and brain.
  • Sequence similarities

    Belongs to the FMO family.
  • Post-translational
    modifications

    The truncated form is probably unable to fold correctly and is rapidly degraded.
    FMO2*1 is sumoylated at 'Lys-492'.
  • Cellular localization

    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310008D08Rik antibody
    • 2310042I22Rik antibody
    • AW107733 antibody
    • Dimethylaniline monooxygenase [N oxide forming] 2 antibody
    • Dimethylaniline monooxygenase [N-oxide-forming] 2 antibody
    • Dimethylaniline oxidase 2 antibody
    • Flavin containing monooxygenase 2 (non functional) antibody
    • Flavin containing monooxygenase 2 antibody
    • FLJ40826 antibody
    • FMO 1B1 antibody
    • FMO 2 antibody
    • FMO antibody
    • FMO pulmonary antibody
    • FMO1B1 antibody
    • FMO2 antibody
    • FMO2_HUMAN antibody
    • MGC28212 antibody
    • OTTMUSP00000028686 antibody
    • OTTMUSP00000028687 antibody
    • Pulmonary flavin containing monooxygenase 2 antibody
    • Pulmonary flavin-containing monooxygenase 2 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for FMO2 using ab234775 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for FMO2 using ab234775 at 1/100 dilution in immunohistochemical analysis.

References

ab234775 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234775.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up