Overview

  • Product name

  • Description

    Rabbit polyclonal to FN3K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FN3K aa 120-191.
    Sequence:

    KLKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWPTFFA RHRLQAQLDLIEKDYADREARE


    Database link: Q9H479

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

PFA-fixed/Triton X-100 permeabilized

Target

  • Relevance

    FN3K catalyzes phosphorylation of fructosamines formed by glycation, the non-enzymatic reaction of glucose with primary amines followed by Amadori re-arrangement. Phosphorylation of fructosamines may initiate metabolism of the modified amine and lead to the de-glycation of fructoselysine and of glycated proteins.
  • Database links

  • Alternative names

    • 2310074G21Rik antibody
    • Fnsk antibody
    • Fructosamine 3 kinase antibody
    • RP23-293H17.4 antibody

Images

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FN3K (green) using ab222318 at 4 µg/ml in ICC/IF.

References

ab222318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up