Overview

  • Product name

  • Description

    Rabbit polyclonal to FN3K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein (His-tag) aa 1-309. Expressed in E.coli. N-terminal tag.
    Sequence:

    MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQ MFEGEVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQA SKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYVDKFGFHTVTC CGFIPQVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWSRLQVKI PDLFCGLEIVPALLHGDLWSGNVAEDDVGPIIYDPASFYGHSEFELAIAL MFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPS LGTMRRLLK


    Database link: Q9H479

  • Positive control

    • WB: Recombinant human FN3K protein; HeLa and HEK-293T cell lysates; Pig heart and brain lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab232766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 35 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    FN3K catalyzes phosphorylation of fructosamines formed by glycation, the non-enzymatic reaction of glucose with primary amines followed by Amadori re-arrangement. Phosphorylation of fructosamines may initiate metabolism of the modified amine and lead to the de-glycation of fructoselysine and of glycated proteins.
  • Database links

  • Alternative names

    • 2310074G21Rik antibody
    • Fnsk antibody
    • Fructosamine 3 kinase antibody
    • RP23-293H17.4 antibody

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for FN3K (green) using ab232766 at 20 μg/ml in ICC/IF. FITC-labeled secondary antibody.

  • All lanes : Anti-FN3K antibody (ab232766) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 3 : Pig heart lysate
    Lane 4 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 35 kDa

  • Anti-FN3K antibody (ab232766) at 2 µg/ml + Recombinant human FN3K protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 35 kDa

References

ab232766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up