Overview

  • Product name

    Anti-FN3K-RP antibody
  • Description

    Rabbit polyclonal to FN3K-RP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FN3K-RP aa 52-214. BC007611.
    Sequence:

    FEGEMASLTAILKTNTVKVPKPIKVLDAPGGGSVLVMEHMDMRHLSSHAA KLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCC GYLPQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIP DLFRDLEIIPALL


    Database link: Q9HA64

  • Positive control

    • 293T, U87 and Jurkat cell lysates; Human fetal kidney tissue.
  • General notes

    Previously labelled as Ketosamine-3-kinase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab199276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 34 kDa.

Target

  • Function

    Phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.
  • Tissue specificity

    Expressed in erythrocytes.
  • Sequence similarities

    Belongs to the fructosamine kinase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.1.- antibody
    • FLJ12171 antibody
    • FN3K related protein antibody
    • FN3K-related protein antibody
    • FN3K-RP antibody
    • FN3KL antibody
    • Fn3krp antibody
    • Fn3krp fructosamine-3-kinase-related protein antibody
    • FN3X antibody
    • Fructosamine-3-kinase-related protein antibody
    • Ketosamine-3-kinase antibody
    • KT3K_HUMAN antibody
    • MGC40640 antibody
    • RGD1304570 antibody
    • RP23-293H17.3 antibody
    • Testis secretory sperm binding protein Li 211a antibody
    see all

Images

  • All lanes : Anti-FN3K-RP antibody (ab199276) at 1/500 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : U87 cell lysate
    Lane 3 : Jurkat cell lysate

    Predicted band size: 34 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal kidney tissue labeling FN3K-RP with ab199276 at 1/100 dilution.

References

ab199276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up