Overview

  • Product name

    Anti-FNBP3 antibody
  • Description

    Rabbit polyclonal to FNBP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FNBP3 aa 202-264.
    Sequence:

    SQTKESRWAKPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEEC TTTSTAPVPTTEI


    Database link: O75400

  • Positive control

    • Human rectum tissue, RT-4 and U-251 MG cell lysate, U-2 OS cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 109 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Binds to WASL/N-WASP and suppresses its translocation from the nucleus to the cytoplasm, thereby inhibiting its cytoplasmic function (By similarity). May be involved in pre-mRNA splicing.
  • Tissue specificity

    Expressed in the brain cortex (at protein level). Widely expressed.
  • Sequence similarities

    Belongs to the PRPF40 family.
    Contains 5 FF domains.
    Contains 2 WW domains.
  • Domain

    The WW domains are essential for localization to nuclear speckles.
  • Cellular localization

    Nucleus speckle. Nucleus matrix. Colocalizes with AKAP8L in the nuclear matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fas ligand associated factor 1 antibody
    • Fas ligand-associated factor 1 antibody
    • FBP 11 antibody
    • FBP11 antibody
    • FLAF 1 antibody
    • FLAF1 antibody
    • FNBP 3 antibody
    • Formin binding protein 11 antibody
    • Formin binding protein 3 antibody
    • Formin-binding protein 11 antibody
    • Formin-binding protein 3 antibody
    • HIP-10 antibody
    • HIP10 antibody
    • Huntingtin interacting protein A antibody
    • Huntingtin interacting protein HYPA antibody
    • Huntingtin yeast partner A antibody
    • Huntingtin-interacting protein 10 antibody
    • Huntingtin-interacting protein A antibody
    • HYPA antibody
    • NY REN 6 antibody
    • NY REN 6 antigen antibody
    • PR40A_HUMAN antibody
    • Pre mRNA processing factor 40 homolog A antibody
    • Pre-mRNA-processing factor 40 homolog A antibody
    • PRP40 pre mRNA processing factor 40 homolog A (S cerevisiae) antibody
    • PRP40 pre mRNA processing factor 40 homolog A (yeast) antibody
    • PRP40 pre mRNA processing factor 40 homolog A antibody
    • PRPF 40A antibody
    • PRPF40A antibody
    • Renal carcinoma antigen NY-REN-6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling FNBP3 with ab204371 at 1/200 dilution.

  • All lanes : Anti-FNBP3 antibody (ab204371) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Developed using the ECL technique.

    Predicted band size: 109 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling FNBP3 with ab204371 at 4 µg/mL (green).

References

ab204371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up