Anti-FNTA antibody - C-terminal (ab186136)
Key features and details
- Rabbit polyclonal to FNTA - C-terminal
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FNTA antibody - C-terminal
See all FNTA primary antibodies -
Description
Rabbit polyclonal to FNTA - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rhesus monkey, Gorilla, Common marmoset
-
Immunogen
Synthetic peptide within Human FNTA aa 329-379 (C terminal). The exact sequence is proprietary. NP_002018.1.
Sequence:NKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQ Q
Database link: P49354 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab186136 was affinity purified using an epitope specific to FNTA immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab186136 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000 - 1/10000. Predicted molecular weight: 44 kDa. | |
| IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK. -
Sequence similarities
Belongs to the protein prenyltransferase subunit alpha family.
Contains 5 PFTA repeats. -
Post-translational
modificationsPhosphorylated. Phosphorylation is mediated by MUSK upon AGRIN stimulation and results in the activation of FNTA. - Information by UniProt
-
Database links
- Entrez Gene: 100401677 Common marmoset
- Entrez Gene: 101147861 Gorilla
- Entrez Gene: 2339 Human
- Entrez Gene: 712681 Rhesus monkey
- Omim: 134635 Human
- SwissProt: P49354 Human
- Unigene: 370312 Human
-
Alternative names
- CAAX farnesyltransferase alpha subunit antibody
- CAAX farnesyltransferase subunit alpha antibody
- EC 2.5.1.58 antibody
see all
Images
-
Immunoprecipitation - Anti-FNTA antibody - C-terminal (ab186136)Detection of FNTA in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab186136 at 6 µg per reaction for IP (Lane 1). For WB detection, ab186136 was used at 1µg/ml. Lane 2 Control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.
-
Western blot - Anti-FNTA antibody - C-terminal (ab186136)All lanes : Anti-FNTA antibody - C-terminal (ab186136) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 44 kDa
Exposure time: 3 minutes
Protocols
Datasheets and documents
References (1)
ab186136 has been referenced in 1 publication.
- Mohammad G et al. Functional Regulation of an Oxidative Stress Mediator, Rac1, in Diabetic Retinopathy. Mol Neurobiol 56:8643-8655 (2019). PubMed: 31300985
