Anti-FNTA antibody - C-terminal (ab186136)
- Datasheet
- References (1)
- Protocols
Overview
-
Product name
Anti-FNTA antibody - C-terminal
See all FNTA primary antibodies -
Description
Rabbit polyclonal to FNTA - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rhesus monkey, Gorilla, Common marmoset -
Immunogen
Synthetic peptide within Human FNTA aa 329-379 (C terminal). The exact sequence is proprietary. NP_002018.1.
Sequence:NKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQ Q
Database link: P49354 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab186136 was affinity purified using an epitope specific to FNTA immobilized on a solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab186136 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 44 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Catalyzes the transfer of a farnesyl or geranyl-geranyl moiety from farnesyl or geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. The alpha subunit is thought to participate in a stable complex with the substrate. The beta subunit binds the peptide substrate. Through RAC1 prenylation and activation may positively regulate neuromuscular junction development downstream of MUSK. -
Sequence similarities
Belongs to the protein prenyltransferase subunit alpha family.
Contains 5 PFTA repeats. -
Post-translational
modificationsPhosphorylated. Phosphorylation is mediated by MUSK upon AGRIN stimulation and results in the activation of FNTA. - Information by UniProt
-
Database links
- Entrez Gene: 100401677 Common marmoset
- Entrez Gene: 101147861 Gorilla
- Entrez Gene: 2339 Human
- Entrez Gene: 712681 Rhesus monkey
- Omim: 134635 Human
- SwissProt: P49354 Human
- Unigene: 370312 Human
-
Alternative names
- CAAX farnesyltransferase alpha subunit antibody
- CAAX farnesyltransferase subunit alpha antibody
- EC 2.5.1.58 antibody
see all
Images
-
Detection of FNTA in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab186136 at 6 µg per reaction for IP (Lane 1). For WB detection, ab186136 was used at 1µg/ml. Lane 2 Control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.
-
All lanes : Anti-FNTA antibody - C-terminal (ab186136) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 44 kDa
Exposure time: 3 minutes
Datasheets and documents
References
This product has been referenced in:
- Mohammad G et al. Functional Regulation of an Oxidative Stress Mediator, Rac1, in Diabetic Retinopathy. Mol Neurobiol 56:8643-8655 (2019). Read more (PubMed: 31300985) »