Overview

  • Product name

    Anti-Focadhesin antibody
  • Description

    Rabbit polyclonal to Focadhesin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Focadhesin aa 1407-1533.
    Sequence:

    NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIH SLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELC PSALHGLSQAMKLPSPAHHLWSLLSEA


    Database link: Q5VW36

  • Positive control

    • Human small intestine tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potential tumor suppressor in gliomas.
  • Tissue specificity

    Ubiquitous. High expression in brain followed by testis, muscle, pancreas, heart, ovary, small intestine, placenta, prostate, thymus, kidney, colon, liver, lung, spleen and leukocytes. Expression is reduced in most glioblastomas and all glioblastoma cell lines.
  • Cellular localization

    Membrane. Cell junction > focal adhesion. Colocalizes with VCL in astrocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • FOCAD antibody
    • FOCAD_HUMAN antibody
    • Focadhesin antibody
    • KIAA1797 antibody

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling Focadhesin with ab185462 at 1/50 dilution.

References

ab185462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up