Overview

  • Product name

    Anti-Folate Binding Protein/FBP antibody
    See all Folate Binding Protein/FBP primary antibodies
  • Description

    Rabbit polyclonal to Folate Binding Protein/FBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Folate Binding Protein/FBP aa 33-68 conjugated to keyhole limpet haemocyanin.
    Sequence:

    LLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCST


    Database link: P15328

  • Positive control

    • IHC-P: Human lung and kidney tissues. WB: HeLa cell lysate. Flow: HeLa cells.
  • General notes

    Previously labelled as Folate Binding Protein

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/100.
WB 1/1000. Predicted molecular weight: 30 kDa.
Flow Cyt 1/10 - 1/50.

Target

  • Function

    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells.
  • Tissue specificity

    Exclusively expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum.
  • Involvement in disease

    Defects in FOLR1 are the cause of neurodegeneration due to cerebral folate transport deficiency (NCFTD) [MIM:613068]. NCFTD is an autosomal recessive disorder resulting from brain-specific folate deficiency early in life. Onset is apparent in late infancy with severe developmental regression, movement disturbances, epilepsy, and leukodystrophy. Note=Recognition and diagnosis of this disorder is critical because folinic acid therapy can reverse the clinical symptoms and improve brain abnormalities and function.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Post-translational
    modifications

    Eight disulfide bonds are present.
    The secreted form is derived from the membrane-bound form either by cleavage of the GPI anchor, or/and by proteolysis catalyzed by a metalloprotease.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • adult antibody
    • Adult folate binding protein antibody
    • Adult folate-binding protein antibody
    • FBP antibody
    • Folate Binding Protein antibody
    • Folate Receptor 1 Adult antibody
    • Folate receptor 1 antibody
    • Folate Receptor 1 Precursor antibody
    • Folate receptor adult antibody
    • Folate receptor alpha antibody
    • Folate receptor antibody
    • FOLR antibody
    • FOLR1 antibody
    • FOLR1_HUMAN antibody
    • FR alpha antibody
    • FR-alpha antibody
    • FRalpha antibody
    • KB cells FBP antibody
    • MOV18 antibody
    • Ovarian cancer associated antigen antibody
    • Ovarian tumor associated antigen antibody
    • Ovarian tumor associated antigen MOv18 antibody
    • Ovarian tumor-associated antigen MOv18 antibody
    see all

Images

  • Flow cytometric analysis of HeLA (human epithelial cell line from cervix adenocarcinoma) cells labeling Folate Binding Protein/FBP with ab230469at 1/10 dilution (green) compared with a negative control (blue).

    FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

  • Formalin-fixed, paraffin-embedded human lung tissue stained for Folate Binding Protein/FBP antibody using ab230469 at 1/10 dilution in immunohistochemical analysis. 

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Folate Binding Protein/FBP antibody using ab230469 at 1/10 dilution in immunohistochemical analysis.

  • Anti-Folate Binding Protein/FBP antibody (ab230469) at 1/1000 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate at 35 µg

    Secondary
    goat anti-rabbit IgG H&L(HRP) at 1/5000 dilution

    Developed using the ECL technique.

    Predicted band size: 30 kDa

References

ab230469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Brain - Alzheimer's disease)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: EDTA pH = 8
Permeabilization
No
Specification
Brain - Alzheimer's disease
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 21°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Mar 01 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up