Overview

  • Product name

    Anti-Folate Receptor 4 antibody
    See all Folate Receptor 4 primary antibodies
  • Description

    Rabbit polyclonal to Folate Receptor 4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Folate Receptor 4 aa 56-234. (Expressed in E.coli).
    Sequence:

    CTRSTSWEAHLEEPLLFNFSMMHCGLLTPACRKHFIQAICFHECSPNLGP WIQPVVPNGQEEQRVWGVPLCQEDCEDWWRACHSSLTCKSNWLHGWDWSE EKKHCPAHEPCLPFSYHFPTPDDLCEKIWNNTFKASPERRNSGRCLQKWF EPTLSNPNVEVALHFAGSALAPQLSYTLP


    Database link: Q9EQF4

  • Positive control

    • WB: Mouse thymus lysate; Recombinant mouse Folate Receptor 4 protein. IHC-P: Mouse lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Folate receptor 4 is a highly expressed cell surface marker of regulatory T cells.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • 0910001L11Rik antibody
    • C86255 antibody
    • Folate binding protein 3 antibody
    • Folate receptor 4 antibody
    • Folbp3 antibody
    • Folr4 antibody
    • FR delta antibody
    • FR4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for Folate Receptor 4 using ab233142 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Folate Receptor 4 antibody (ab233142) at 3 µg/ml + Mouse thymus lysate

    Predicted band size: 28 kDa

  • Anti-Folate Receptor 4 antibody (ab233142) at 2 µg/ml + Recombinant mouse Folate Receptor 4 protein

    Predicted band size: 28 kDa

References

ab233142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up