Overview

  • Product name

  • Description

    Rabbit polyclonal to Follistatin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Follistatin aa 80-130 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    IFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKG P


    Database link: P19883

  • Positive control

    • Human breast carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 38 kDa.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human breast carcinoma tissue labeling Follistatin with ab203131 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Rheaume BA  et al. Single cell transcriptome profiling of retinal ganglion cells identifies cellular subtypes. Nat Commun 9:2759 (2018). Read more (PubMed: 30018341) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Baboon Tissue sections (Adult testis)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Sodium citrate
Permeabilization
No
Specification
Adult testis
Blocking step
5% serum + 3% BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Mar 10 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up