Overview

  • Product name

    Anti-FOLR3 antibody [OTI6C1]
    See all FOLR3 primary antibodies
  • Description

    Mouse monoclonal [OTI6C1] to FOLR3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FOLR3. (NP_000795) produced in E.coli.
    Sequence:

    MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPE DELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHF IQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSY TCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVS NYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS


    Database link: P41439

  • Positive control

    • IHC-P: Human spleen tissue. WB: pCMV6-ENTRY FOLR3 cDNA transfected HEK-293T cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI6C1
  • Isotype

    IgG1

Applications

Our Abpromise guarantee covers the use of ab236384 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 28 kDa.
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

Target

  • Function

    Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.
  • Tissue specificity

    Spleen, thymus, bone marrow, ovarian carcinoma, and uterine carcinoma.
  • Sequence similarities

    Belongs to the folate receptor family.
  • Post-translational
    modifications

    Eight disulfide bonds are present.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Folate receptor 3 (gamma) antibody
    • Folate receptor 3 antibody
    • Folate receptor gamma antibody
    • FOLR3 antibody
    • FOLR3_HUMAN antibody
    • FR G antibody
    • FR-gamma antibody
    • Gamma hFR antibody
    see all

Images

  • All lanes : Anti-FOLR3 antibody [OTI6C1] (ab236384) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY FOLR3 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 28 kDa

  • Paraffin-embedded human spleen tissue stained for FOLR3 with ab236384 at a 1/150 dilution in immunohistochemical analysis.

References

ab236384 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236384.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up