Overview

  • Product name

  • Description

    Rabbit polyclonal to FOXE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human FOXE1 aa 184-365.
    Sequence:

    AVPAARPPYPGAVYAGYAPPSLAAPPPVYYPAASPGPCRVFGLVPERPLS PELGPAPSGPGGSCAFASAGAPATTTGYQPAGCTGARPANPSAYAAAYAG PDGAYPQGAGSAIFAAAGRLAGPASPPAGGSSGGVETTVDFYGRTSPGQF GALGACYNPGGQLGGASAGAYHARHAAAYPGG


    Database link: O00358

  • Positive control

    • WB: Mouse kidney and brain lysates. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 38 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probable transcription factor. Could be involved in thyroid gland organogenesis.
  • Tissue specificity

    Detected in adult brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, heart, colon, small intestine testis and thymus. Expression was strongest in heart and pancreas.
  • Involvement in disease

    Defects in FOXE1 are the cause of Bamforth-Lazarus syndrome (BLS) [MIM:241850]. BLS is associated with thyroid agenesis, cleft palate and choanal atresia.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FKH L15 antibody
    • FKHL 15 antibody
    • FKHL15 antibody
    • Forkhead (Drosophila) like 15 antibody
    • Forkhead box E1 antibody
    • Forkhead box E2 antibody
    • Forkhead box protein E1 antibody
    • Forkhead box protein E2 antibody
    • Forkhead drosophila homolog like 15 antibody
    • Forkhead like 15 antibody
    • Forkhead related protein FKHL 15 antibody
    • Forkhead related protein FKHL15 antibody
    • Forkhead-related protein FKHL15 antibody
    • FOX E1 antibody
    • FOX E2 antibody
    • FOXE 1 antibody
    • FOXE 2 antibody
    • FOXE1 antibody
    • FOXE1_HUMAN antibody
    • FOXE2 antibody
    • HFKH 4 antibody
    • HFKH4 antibody
    • HFKL 5 antibody
    • HFKL5 antibody
    • HNF-3/fork head-like protein 5 antibody
    • Thyroid transcription factor 2 antibody
    • TITF 2 antibody
    • TITF2 antibody
    • TTF 2 antibody
    • TTF-2 antibody
    • TTF2 antibody
    see all

Images

  • All lanes : Anti-FOXE1 antibody (ab236661) at 1/500 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling FOXE1 using ab236661 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Mouse Tissue sections (thyroid gland)
Antigen retrieval step
None
Permeabilization
No
Specification
thyroid gland
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 20 · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Mar 12 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up