Overview

  • Product name

    Anti-FoxJ1 antibody [CL3991]
    See all FoxJ1 primary antibodies
  • Description

    Mouse monoclonal [CL3991] to FoxJ1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FoxJ1 aa 183-307.
    Sequence:

    PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEP SAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRV AKVPRPPSTLLPTPEEQGELEPLKG


    Database link: Q92949

  • Epitope

    Binds to an epitope located within the peptide sequence GFWRIDPQYA (aa 193-202) as determined by overlapping synthetic peptides.
  • Positive control

    • Human fallopian tube and endometrium tissues.
  • General notes

     This product was previously labelled as HFH4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play an important role in cell fate determination during lung development and in spermatogenesis.
  • Tissue specificity

    Testis, oviduct, lung and brain cortex.
  • Involvement in disease

    Genetic variations in FOXJ1 may be associated with susceptibility to allergic rhinitis (ALRH) [MIM:607154]. Allergic rhinitis is a common disease of complex inheritance and is characterized by mucosal inflammation caused by allergen exposure.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Developmental stage

    Expressed in developing lung, kidney and central nervous system.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FKHL13 antibody
    • Forkhead box J1 antibody
    • Forkhead box protein J1 antibody
    • Forkhead Homologue 4 antibody
    • Forkhead related protein FKHL13 antibody
    • Forkhead-related protein FKHL13 antibody
    • Fox J1 antibody
    • Foxj1 antibody
    • FOXJ1_HUMAN antibody
    • Hepatocyte nuclear factor 3 forkhead homolog 4 antibody
    • HFH 4 antibody
    • HFH-4 antibody
    • HFH4 antibody
    • HNF 3/forkhead homolog 4 antibody
    • MGC35202 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human fallopian tube tissue labeling FoxJ1 with ab220029 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human endometrium tissue labeling FoxJ1 with ab220029 at 1/200 dilution.

References

ab220029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up