Overview

  • Product name

  • Description

    Rabbit polyclonal to FOXL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to Human FOXL1 aa 99-129 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    HNLSLNDCFVKVPREKGRPGKGSYWTLDPRC


    Database link: Q12952

  • Positive control

    • Human testis tissue, CHO cell lysate, mouse kidney tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab190226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 36 kDa.
IHC-P 1/100.

Target

  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FKH 6 antibody
    • FKH6 antibody
    • FKHL 11 antibody
    • FKHL11 antibody
    • Forkhead (Drosophila) like 11 antibody
    • Forkhead box L1 antibody
    • Forkhead box protein L1 antibody
    • Forkhead related protein FKHL11 antibody
    • Forkhead related transcription factor 7 antibody
    • Forkhead-related protein FKHL11 antibody
    • Forkhead-related transcription factor 7 antibody
    • FOX L1 antibody
    • FOXL 1 antibody
    • Foxl1 antibody
    • FOXL1_HUMAN antibody
    • FREAC 7 antibody
    • FREAC-7 antibody
    • FREAC7 antibody
    see all

Images

  • Anti-FOXL1 antibody (ab190226) at 1/1000 dilution + mouse kidney tissue lysate at 35 µg

    Predicted band size: 36 kDa

  • Anti-FOXL1 antibody (ab190226) at 1/1000 dilution + CHO cell lysate at 35 µg

    Predicted band size: 36 kDa

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human testis tissue labeling FOXL1 with ab190226 at 1/100 dilution.

References

ab190226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up