Anti-FOXM1 antibody [6F11A8] (ab234077)

Submit a review Submit a question

Overview

  • Product name

    Anti-FOXM1 antibody [6F11A8]
    See all FOXM1 primary antibodies

  • Description

    Mouse monoclonal [6F11A8] to FOXM1

  • Host species

    Mouse

  • Tested applications

    Suitable for: WB, Flow Cytmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human FOXM1 aa 649-748. Expressed in E. coli.
    Sequence:

    PLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDID VPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPL


    Database link: Q08050

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • Flow Cytometry: HeLa cells. WB: FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate; Recombinant human FOXM1 (amino acids: 649-748) protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab234077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Transcriptional activatory factor. May play a role in the control of cell proliferation.

  • Tissue specificity

    Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.

  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.

  • Developmental stage

    Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.

  • Domain

    Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.

  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    • Alternative names

      • FKHL16 antibody
      • Forkhead box M1 antibody
      • Forkhead box protein M1 antibody
      • forkhead like 16 antibody
      • Forkhead-related protein FKHL16 antibody
      • FOX M1 antibody
      • Foxm1 antibody
      • FOXM1_HUMAN antibody
      • FOXM1B antibody
      • Hepatocyte nuclear factor 3 forkhead homolog 11 antibody
      • HFH-11 antibody
      • HFH11 antibody
      • HNF-3/fork-head homolog 11 antibody
      • HNF3 antibody
      • INS1 antibody
      • M phase phosphoprotein 2 antibody
      • M-phase phosphoprotein 2 antibody
      • MPHOSPH2 antibody
      • MPM-2 reactive phosphoprotein 2 antibody
      • MPP2 antibody
      • PIG29 antibody
      • TGT3 antibody
      • Transcription factor Trident antibody
      • Trident antibody
      • WIN antibody
      • Winged-helix factor from INS-1 cells antibody
      • Winged-helix factor from INS1 cells antibody
      see all

    Images

    • Flow Cytometry - Anti-FOXM1 antibody [6F11A8] (ab234077)
      Flow Cytometry - Anti-FOXM1 antibody [6F11A8] (ab234077)

      Flow Cytometry analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells, labeling FOXM1 with ab234077 at a 1/200 dilution (green) compared to a negative control (red).

    • Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)
      Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)
      All lanes : Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution

      Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
      Lane 2 : FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate
    • Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)
      Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)
      Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution + Recombinant human FOXM1 (amino acids: 649-748) protein


      Expected recombinant MW is 36.6 kDa

    References

    ab234077 has not yet been referenced specifically in any publications.

    Publishing research using ab234077? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab234077.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up