Anti-FOXM1 antibody [6F11A8] (ab234077)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FOXM1 antibody [6F11A8]
See all FOXM1 primary antibodies -
Description
Mouse monoclonal [6F11A8] to FOXM1 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FOXM1 aa 649-748. Expressed in E. coli.
Sequence:PLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDID VPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPL
Database link: Q08050 -
Positive control
- Flow Cytometry: HeLa cells. WB: FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate; Recombinant human FOXM1 (amino acids: 649-748) protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6F11A8 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab234077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/100 - 1/500. | |
Flow Cyt | 1/200 - 1/400. |
Target
-
Function
Transcriptional activatory factor. May play a role in the control of cell proliferation. -
Tissue specificity
Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis. -
Sequence similarities
Contains 1 fork-head DNA-binding domain. -
Developmental stage
Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus. -
Domain
Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4. -
Post-translational
modificationsPhosphorylated in M (mitotic) phase. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2305 Human
- Omim: 602341 Human
- SwissProt: Q08050 Human
- Unigene: 239 Human
-
Alternative names
- FKHL16 antibody
- Forkhead box M1 antibody
- Forkhead box protein M1 antibody
see all
Images
-
Flow Cytometry analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells, labeling FOXM1 with ab234077 at a 1/200 dilution (green) compared to a negative control (red).
-
All lanes : Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate -
Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution + Recombinant human FOXM1 (amino acids: 649-748) protein
Expected recombinant MW is 36.6 kDa
Datasheets and documents
References
ab234077 has not yet been referenced specifically in any publications.