Anti-FOXM1 antibody [6F11A8] (ab234077)
Key features and details
- Mouse monoclonal [6F11A8] to FOXM1
- Suitable for: WB, Flow Cyt
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-FOXM1 antibody [6F11A8]
See all FOXM1 primary antibodies -
Description
Mouse monoclonal [6F11A8] to FOXM1 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FOXM1 aa 649-748. Expressed in E. coli.
Sequence:PLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDID VPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPL
Database link: Q08050 -
Positive control
- Flow Cytometry: HeLa cells. WB: FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate; Recombinant human FOXM1 (amino acids: 649-748) protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
6F11A8 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab234077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/100 - 1/500. | |
| Flow Cyt | 1/200 - 1/400. |
Target
-
Function
Transcriptional activatory factor. May play a role in the control of cell proliferation. -
Tissue specificity
Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis. -
Sequence similarities
Contains 1 fork-head DNA-binding domain. -
Developmental stage
Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus. -
Domain
Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4. -
Post-translational
modificationsPhosphorylated in M (mitotic) phase. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2305 Human
- Omim: 602341 Human
- SwissProt: Q08050 Human
- Unigene: 239 Human
-
Alternative names
- FKHL16 antibody
- Forkhead box M1 antibody
- Forkhead box protein M1 antibody
see all
Images
-
![Flow Cytometry - Anti-FOXM1 antibody [6F11A8] (ab234077)](https://www.abcam.com/ps/products/234/ab234077/Images/ab234077-307889-anti-foxm1-antibody-6f11a8-flow-cytometry.jpg)
Flow Cytometry - Anti-FOXM1 antibody [6F11A8] (ab234077)Flow Cytometry analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells, labeling FOXM1 with ab234077 at a 1/200 dilution (green) compared to a negative control (red).
-
![Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)](https://www.abcam.com/ps/products/234/ab234077/Images/ab234077-307888-anti-foxm1-antibody-6f11a8-western-blot.jpg)
Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)All lanes : Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution
Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
Lane 2 : FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate -
![Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)](https://www.abcam.com/ps/products/234/ab234077/Images/ab234077-307887-anti-foxm1-antibody-6f11a8-western-blot.jpg)
Western blot - Anti-FOXM1 antibody [6F11A8] (ab234077)Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution + Recombinant human FOXM1 (amino acids: 649-748) proteinExpected recombinant MW is 36.6 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab234077 has not yet been referenced specifically in any publications.
