Overview

  • Product name

    Anti-FOXM1 antibody [6F11A8]
    See all FOXM1 primary antibodies
  • Description

    Mouse monoclonal [6F11A8] to FOXM1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FOXM1 aa 649-748. Expressed in E. coli.
    Sequence:

    PLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDID VPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPL


    Database link: Q08050

  • Positive control

    • Flow Cytometry: HeLa cells. WB: FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate; Recombinant human FOXM1 (amino acids: 649-748) protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab234077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Transcriptional activatory factor. May play a role in the control of cell proliferation.
  • Tissue specificity

    Expressed in thymus, testis, small intestine, colon followed by ovary. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors. Also expressed in epithelial cell lines derived from tumors. Not expressed in resting cells. Isoform 2 is highly expressed in testis.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Developmental stage

    Embryonic expression pattern: liver, lung, intestine, kidney, urinary tract; adult expression pattern: intestine, colon, testis and thymus.
  • Domain

    Within the protein there is a domain which acts as a transcriptional activator. Insertion of a splicing sequence within it inactivates this transcriptional activity, as it is the case for isoform 4.
  • Post-translational
    modifications

    Phosphorylated in M (mitotic) phase.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FKHL16 antibody
    • Forkhead box M1 antibody
    • Forkhead box protein M1 antibody
    • forkhead like 16 antibody
    • Forkhead-related protein FKHL16 antibody
    • FOX M1 antibody
    • Foxm1 antibody
    • FOXM1_HUMAN antibody
    • FOXM1B antibody
    • Hepatocyte nuclear factor 3 forkhead homolog 11 antibody
    • HFH-11 antibody
    • HFH11 antibody
    • HNF-3/fork-head homolog 11 antibody
    • HNF3 antibody
    • INS1 antibody
    • M phase phosphoprotein 2 antibody
    • M-phase phosphoprotein 2 antibody
    • MPHOSPH2 antibody
    • MPM-2 reactive phosphoprotein 2 antibody
    • MPP2 antibody
    • PIG29 antibody
    • TGT3 antibody
    • Transcription factor Trident antibody
    • Trident antibody
    • WIN antibody
    • Winged-helix factor from INS-1 cells antibody
    • Winged-helix factor from INS1 cells antibody
    see all

Images

  • Flow Cytometry analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells, labeling FOXM1 with ab234077 at a 1/200 dilution (green) compared to a negative control (red).

  • All lanes : Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : FOXM1 (amino acids: 649-748)-hIgGFc transfected HEK-293 cell lysate
  • Anti-FOXM1 antibody [6F11A8] (ab234077) at 1/100 dilution + Recombinant human FOXM1 (amino acids: 649-748) protein


    Expected recombinant MW is 36.6 kDa

References

ab234077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up