Overview

  • Product name

    Anti-FOXN2 antibody [OTI5H8]
    See all FOXN2 primary antibodies
  • Description

    Mouse monoclonal [OTI5H8] to FOXN2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FOXN2 aa 1-431. (NP_002149) produced in E.coli.
    Sequence:

    MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSE SADDELTNLNWLHESTNLLTNFSLGSEGLPIVSPLYDIEGDDVPSFGPAC YQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYSWILDHFPYFA TAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQA LKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTS IEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKE DHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEA AGSLLHLAGIRTCLGSLISTAKTQNQKQRKK


    Database link: P32314-1

  • Positive control

    • WB: pCMV6-ENTRY FOXN2 cDNA transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 47 kDa.

Target

  • Function

    Binds to the purine-rich region in HTLV-I LTR.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3230402J05Rik antibody
    • 6030465J18Rik antibody
    • Fkh19 antibody
    • Forkhead box N2 antibody
    • Forkhead box protein N2 antibody
    • Foxn1 antibody
    • foxn2 antibody
    • FOXN2_HUMAN antibody
    • HTLF antibody
    • Human T-cell leukemia virus enhancer factor antibody
    see all

Images

  • All lanes : Anti-FOXN2 antibody [OTI5H8] (ab236385) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY FOXN2 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 47 kDa

References

ab236385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up