Anti-FOXP1 antibody (ab93807)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FOXP1 antibody
See all FOXP1 primary antibodies -
Description
Rabbit polyclonal to FOXP1 -
Host species
Rabbit -
Specificity
FOXP1 -
Tested applications
Suitable for: IHC-P, WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Horse, Cow, Dog, Pig, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, Xenopus tropicalis, Elephant
-
Immunogen
Synthetic peptide corresponding to Human FOXP1 aa 627-677.
Sequence:MQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPDFDHDRDYEDEPVNEDM E
-
Positive control
- HeLa lysate and 293T cells
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: Tris citrate/phosphate -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab93807 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/500 - 1/2000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| WB | 1/2000 - 1/10000. Predicted molecular weight: 75 kDa. | |
| IP | Use at 2-5 µg/mg of lysate. |
Target
-
Function
Transcriptional repressor. It plays an important role in the specification and differentiation of lung epithelium. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Essential transcriptional regulator of B cell development. -
Involvement in disease
Note=A chromosomal aberration involving FOXP1 is found in acute lymphoblastic leukemia. Translocation t(9;3)(p13;p14.1) with PAX5.
Defects in FOXP1 are the cause of mental retardation with language impairment and autistic features (MRLIAF) [MIM:613670]. It is a developmental disorder characterized by mild to moderate mental retardation, language impairment, and autistic features. Patients show global delay, delayed walking, severely delayed speech development, and behavioral abnormalities, including irritability, hyperactivity, aggression, and stereotypical rigid behaviors. -
Sequence similarities
Contains 1 C2H2-type zinc finger.
Contains 1 fork-head DNA-binding domain. -
Domain
The leucine-zipper is required for dimerization and transcriptional repression. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 515903 Cow
- Entrez Gene: 484692 Dog
- Entrez Gene: 27086 Human
- Entrez Gene: 108655 Mouse
- Entrez Gene: 297480 Rat
- Entrez Gene: 496386 Xenopus laevis
- Entrez Gene: 779033 Xenopus laevis
- Omim: 605515 Human
see all -
Alternative names
- 12CC4 antibody
- FLJ23741 antibody
- Fork head related protein like B antibody
see all
Images
-
Western blot - Anti-FOXP1 antibody (ab93807)All lanes : Anti-FOXP1 antibody (ab93807) at 0.1 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : HeLa lysate at 5 µg
Lane 4 : 293 T cells at 50 µg
Developed using the ECL technique.
Predicted band size: 75 kDa
Exposure time: 3 minutes -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FOXP1 antibody (ab93807)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate carcinoma (left) and mouse hybridoma tumor (right) tissues labelling FOXP1 with ab93807 at 1/1000 (1µg/ml). Detection: DAB. -
Immunoprecipitation - Anti-FOXP1 antibody (ab93807)Immunoprecipitation of FOXP1 in whole cell lysate from HeLa cells (1 mg for IP, 20% of IP loaded) using ab93807 at 3µg/mg lysate. Subsequent WB detections was performed using 1µg/ml ab93807.
Datasheets and documents
References
ab93807 has not yet been referenced specifically in any publications.
