Overview

  • Product name

  • Description

    Rabbit polyclonal to FOXP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis, Chimpanzee, Rhesus monkey, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human FOXP2 aa 214-445.
    Sequence:

    QLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSP AEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITH HSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFGQF LKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRP SEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQ


    Database link: O15409

  • Positive control

    • Human fetal brain tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab207587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 80 kDa.

Target

  • Function

    Transcriptional repressor that may play a role in the specification and differentiation of lung epithelium. May also play a role in developing neural, gastrointestinal and cardiovascular tissues. Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential. Involved in neural mechanisms mediating the development of speech and language.
  • Tissue specificity

    Isoform 1 and isoform 6 are expressed in adult and fetal brain, caudate nucleus and lung.
  • Involvement in disease

    Defects in FOXP2 are the cause of speech-language disorder 1 (SPCH1) [MIM:602081]; also known as autosomal dominant speech and language disorder with orofacial dyspraxia. Affected individuals have a severe impairment in the selection and sequencing of fine orofacial movements, which are necessary for articulation. They also show deficits in several facets of language processing (such as the ability to break up words into their constituent phonemes) and grammatical skills.
    Note=A chromosomal aberration involving FOXP2 is a cause of severe speech and language impairment. Translocation t(5;7)(q22;q31.2).
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 fork-head DNA-binding domain.
  • Developmental stage

    Expressed in the brain at 15 and 22 weeks of gestation, with a pattern of strong cortical, basal ganglia, thalamic and cerebellar expression. Highly expressed in the head and tail of nucleus caudatus and putamen. Restricted expression within the globus pallidus, with high levels in the pars interna, which provides the principal source of output from the basal ganglia to the nucleus centrum medianum thalami (CM) and the major motor relay nuclei of the thalamus. In the thalamus, present in the CM and nucleus medialis dorsalis thalami. Lower levels are observed in the nuclei anterior thalami, dorsal and ventral, and the nucleus parafascicularis thalami. Expressed in the ventrobasal complex comprising the nucleus ventralis posterior lateralis/medialis. The ventral tier of the thalamus exhibits strong expression, including nuclei ventralis anterior, lateralis and posterior lateralis pars oralis. Also expressed in the nucleus subthalamicus bilaterally and in the nucleus ruber.
  • Domain

    The leucine-zipper is required for dimerization and transcriptional repression.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAG repeat protein 44 antibody
    • CAGH44 antibody
    • DKFZp686H1726 antibody
    • Forkhead box P2 antibody
    • Forkhead box protein P2 antibody
    • forkhead/winged-helix transcription factor antibody
    • FOX P2 antibody
    • FOXP2 antibody
    • FOXP2_HUMAN antibody
    • HGNC11222 antibody
    • HGNC11956 antibody
    • SPCH 1 antibody
    • SPCH1 antibody
    • TNRC 10 antibody
    • TNRC10 antibody
    • trinucleotide repeat containing 10 antibody
    • Trinucleotide repeat containing gene 10 protein antibody
    • Trinucleotide repeat-containing gene 10 protein antibody
    see all

Images

  • Anti-FOXP2 antibody (ab207587) at 1/500 dilution + Human fetal brain tissue lysate

    Predicted band size: 80 kDa

References

ab207587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunoprecipitation
Sample
Human Cell lysate - whole cell (HEK293)
Total protein in input
800 µg
Immuno-precipitation step
Protein A/G
Specification
HEK293

Abcam user community

Verified customer

Submitted Oct 26 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up