Overview

  • Product name

    Anti-FOXP3 antibody [3G3] (Allophycocyanin)
    See all FOXP3 primary antibodies
  • Description

    Mouse monoclonal [3G3] to FOXP3 (Allophycocyanin)
  • Host species

    Mouse
  • Conjugation

    Allophycocyanin. Ex: 645nm, Em: 660nm
  • Tested applications

    Suitable for: Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse FOXP3 aa 1-429.
    Sequence:

    MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDL RSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH FMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPP GINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKW PGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKE KLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREA PDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAI LEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVES EKGAVWTVDEFEFRKKRSQRPNKCSNPCP


    Database link: Q99JB6

  • Epitope

    The mouse monoclonal antibody 3G3 recognizes the N-terminal region of FOXP3.

Properties

Applications

Our Abpromise guarantee covers the use of ab200568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

Target

  • Function

    Probable transcription factor. Plays a critical role in the control of immune response.
  • Involvement in disease

    Defects in FOXP3 are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX) [MIM:304790]; also known as X-linked autoimmunity-immunodeficiency syndrome. IPEX is characterized by neonatal onset insulin-dependent diabetes mellitus, infections, secretory diarrhea, trombocytopenia, anemia and eczema. It is usually lethal in infancy.
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AIID antibody
    • DIETER antibody
    • Forkhead box P3 antibody
    • Forkhead box protein P3 antibody
    • FOXP3 antibody
    • FOXP3_HUMAN antibody
    • FOXP3delta7 antibody
    • Immune dysregulation polyendocrinopathy enteropathy X linked antibody
    • Immunodeficiency polyendocrinopathy enteropathy X linked antibody
    • IPEX antibody
    • JM2 antibody
    • MGC141961 antibody
    • MGC141963 antibody
    • OTTHUMP00000025832 antibody
    • OTTHUMP00000025833 antibody
    • OTTHUMP00000226737 antibody
    • PIDX antibody
    • Scurfin antibody
    • XPID antibody
    see all

References

ab200568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up