Overview

  • Product name

  • Description

    Mouse polyclonal to FOXQ1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human FOXQ1 aa 110-219. (NP_150285).
    Sequence:

    RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGS YTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVF RRRRKRLSHR


    Database link: Q9C009

  • Positive control

    • HeLa S3 nuclear extract; Recombinant Human FOXQ1 protein (immunogen).

Properties

Applications

Our Abpromise guarantee covers the use of ab194564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 41 kDa.

Target

  • Tissue specificity

    Expressed predominantly in the stomach, trachea, bladder and salivary gland.
  • Sequence similarities

    Contains 1 fork-head DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Forkhead box protein Q1 antibody
    • Forkhead box Q1 antibody
    • FOX Q1 antibody
    • FOXQ 1 antibody
    • FOXQ1 antibody
    • FOXQ1_HUMAN antibody
    • Hepatocyte nuclear factor 3 forkhead antibody
    • Hepatocyte nuclear factor 3 forkhead homolog 1 antibody
    • HFH 1 antibody
    • HFH-1 antibody
    • HFH1 antibody
    • HNF 3/forkhead like protein 1 antibody
    • HNF-3/forkhead-like protein 1 antibody
    • HNF3/forkhead like protein 1 antibody
    • MGC77469 antibody
    • Q1 antibody
    • Winged helix / forkhead transcription factor antibody
    • Winged helix/forkhead transcription factor antibody
    • zgc:77469 antibody
    see all

Images

  • Anti-FOXQ1 antibody (ab194564) at 1/500 dilution + HeLa S3 nuclear extract at 50 µg

    Developed using the ECL technique.

    Predicted band size: 41 kDa

  • Anti-FOXQ1 antibody (ab194564) at 1/1000 dilution + Recombinant Human FOXQ1 protein (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 41 kDa



    Predicted MWt of immunogen: 38.21 kDa.

References

ab194564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up