Overview

  • Product name

  • Description

    Rabbit polyclonal to FOXRED1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human FOXRED1 aa 307-486.
    Sequence:

    GPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLG SNYLGGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSA WAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMV LKGRFQTIDLSPFLFTRFYLGEKIQENNII


    Database link: Q96CU9

  • Positive control

    • WB: A549, A431, Jurkat, HeLa, HepG2 whole cell lysates. IHC-P: Human colon cancer and ovarian cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 31,53,54 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Required for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) (PubMed:20858599, PubMed:25678554). Involved in mid-late stages of complex I assembly (PubMed:25678554).
  • Involvement in disease

    Mitochondrial complex I deficiency
  • Cellular localization

    Mitochondrion inner membrane. According to a report, it is associated with the matrix face of the mitochondrial inner membrane and does not contain any transmembrane region. However, one transmembrane domain is clearly predicted by different methods (Probable).
  • Information by UniProt
  • Database links

  • Alternative names

    • FAD dependent oxidoreductase domain containing 1 antibody
    • FAD dependent oxidoreductase domain containing protein 1 antibody
    • FAD-dependent oxidoreductase domain-containing protein 1 antibody
    • FOXRED 1 antibody
    • FOXRED1 antibody
    • FP634 antibody
    • FXRD1_HUMAN antibody
    • H17 antibody
    see all

Images

  • All lanes : Anti-FOXRED1 antibody (ab229860) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 31,53,54 kDa
    Observed band size: 54 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human colon cancer tissue stained for FOXRED1 using ab229860 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for FOXRED1 using ab229860 at 1/100 dilution in immunohistochemical analysis.

References

ab229860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up