Overview

  • Product name

  • Description

    Rabbit polyclonal to FPGS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse FPGS aa 210-439. (Expressed in E.coli).
    Sequence:

    TNIIRKPVVCGVSSLGIDHTSLLGDTVEKIAWQKGGIFKPGVPAFTVVQP EGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGAHQRSNAALA LQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTV WPGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLERSKRTDGGSEVH ILLFNSTGDRDSAALLKLLQPCQFDYAVFC


    Database link: P48760

  • Positive control

    • WB: Recombinant mouse FPGS and HeLa whole cell lysate. IHC-P: Mouse kidney and skeletal muscle tissue.
  • General notes

    Previously labelled as Folylpolyglutamate synthase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab231540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Conversion of folates to polyglutamate derivatives. This allows tissues to concentrate folate at higher levels than in plasma.
  • Pathway

    Cofactor biosynthesis; tetrahydrofolylpolyglutamate biosynthesis.
  • Sequence similarities

    Belongs to the folylpolyglutamate synthase family.
  • Cellular localization

    Mitochondrion. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 6.3.2.17 antibody
    • FOLC antibody
    • FOLC_HUMAN antibody
    • Folylpoly gamma glutamate synthetase antibody
    • Folylpoly-gamma-glutamate synthetase antibody
    • Folylpolyglutamate synthase antibody
    • Folylpolyglutamate synthase mitochondrial antibody
    • FPGS antibody
    • mitochondrial antibody
    • OTTHUMP00000022201 antibody
    • OTTHUMP00000022202 antibody
    • Tetrahydrofolate synthase antibody
    • Tetrahydrofolylpolyglutamate synthase antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse kidney tissue stained for FPGS using ab231540 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded mouse skeletal muscle tissue stained for FPGS using ab231540 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-FPGS antibody (ab231540) at 1 µg/ml + Recombinant mouse FPGS protein

    Predicted band size: 65 kDa

  • Anti-FPGS antibody (ab231540) at 1/50 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Predicted band size: 65 kDa

References

ab231540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up