Overview

  • Product name

  • Description

    Rabbit polyclonal to FRA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse FRA1 aa 1-273. (Expressed in E.coli).
    Sequence:

    MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDSSSQEL HWMVQPHFLGPTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI SPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQRE IEELQKQKERLELVLEAHRPICKIPEGDKKDPGGSGSTSGASSPPAPGRP VPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCSSAH RKSSSSSGDPSSDPLGSPTLLAL


    Database link: P48755

  • Positive control

    • IHC-P: Mouse liver, testis and kidney tissues. WB: K562 cell lysate; Recombinant mouse FRA1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 30 kDa.

Target

Images

  • Paraffin-embedded mouse liver tissue stained for FRA1 using ab232745 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse testis tissue stained for FRA1 using ab232745 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for FRA1 using ab232745 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-FRA1 antibody (ab232745) at 3 µg/ml + Recombinant mouse FRA1 protein

    Predicted band size: 30 kDa

  • Anti-FRA1 antibody (ab232745) at 3 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 30 kDa

References

ab232745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up