Question (64316) | Anti-Fragilis antibody (ab15592)

Go to datasheet (ab15592)

Question

Estimada . Te envío la secuencia de la proteína Fragilis, de la especie bovina. Las referencias de los anticuerpos que tenéis son: ab15592 (anti fragilis-ratón) y ab74699 (anti fragilis-humano).
¡ Muchísimas gracias por tu ayuda y perdona por las molestias ¡
Un cordial saludo.

Answer

He llevado a cabo la alineación de secuencias de la secuencia que me has enviado con la correspondiente al inmunógeno de ab74699 y resulta un porcentaje del 66%:

Sequence type explicitly set to Protein

Sequence format is Pearson

Sequence 1: immunogen 50 aa

Sequence 2: bos 146 aa

Start of Pairwise alignments

Aligning...







Sequences (1:2) Aligned. Score: 66

Guide tree file created: http://www.genome.jp/tools-bin/pushfile?121019190527BdVL1+clustalw.dnd



There are 1 groups

Start of Multiple Alignment



Aligning...

Group 1: Sequences: 2 Score:758

Alignment Score 200



CLUSTAL-Alignment file created http://www.genome.jp/tools-bin/pushfile?121019190527BdVL1+clustalw.aln






http://www.genome.jp/tools-bin/pushfile?121019190527BdVL1+clustalw.aln


CLUSTAL 2.1 multiple sequence alignment





immunogen ----------PVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVW

bos MNRTSQPLFTGAHGAVPPAYEVLKEEHEVAVLGAPQSQAPLTTTVINIRSDTAVPDHIVW

.:.. ** **:*************:. ** *:***:***:*:****:**



immunogen ------------------------------------------------------------

bos SLFNTIFMNWCCLGFVAFAYSVKSRDRKMVGDITGAQSYASTAKCLNICSLVLGILLTVV





immunogen --------------------------

bos LIVLVSTGSLMIVQAVSELMQNYGGH






Para el anticuerpo ab15592 no lo he mirado puesto que al no estar en stock el producto, y siendo la fecha estimada de reincorporarlo al stock mediados finales de Noviembre, pensé que no te interesaría. Si no te importa esperar a que te llegue en un mes / mes y medio, entonces podemos investigar la probabilidad de reaccionar en bovino.

Dime si puedo ayudarte en algo más, o quieres que busquemos productos alternativos.

¡Que pases un estupendo fin de semana!

Sign up