
  • Product name

  • Description

    Rabbit polyclonal to FRZB
  • Host species

  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 216-265 (VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEER S) of Human FRZB (NP_001454).



Our Abpromise guarantee covers the use of ab108169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 0.25 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Relevance

    SFRP3/FRZB appears to be involved in limb skeletogenesis by regulating chondrocyte maturation and long bone development. Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. Antagonist of Wnt8 signaling.
  • Cellular localization

  • Database links

  • Alternative names

    • FIZ antibody
    • FRE antibody
    • Frezzled antibody
    • Fritz antibody
    • Frizzled-related protein 1 antibody
    • FRP antibody
    • FrzB 1 antibody
    • FRZB antibody
    • FRZB1 antibody
    • OTTMUSP00000014350 antibody
    • RP23-33L19.1 antibody
    • Secreted frizzled related protein 3 [Precursor] antibody
    • Secreted frizzled related sequence protein 3 antibody
    • sFRP 3 antibody
    • SFRP antibody
    see all


  • Anti-FRZB antibody (ab108169) at 0.2 µg/ml + Transfected 293T

    Predicted band size: 36 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human spleen tissue labelling FRZB with ab108169 at 5µg/ml.


ab108169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108169.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up