Overview

  • Product name

  • Description

    Rabbit polyclonal to FSH beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Sheep, Rabbit, Goat, Horse, Guinea pig, Cow, Human, Pig, Chimpanzee, Cynomolgus monkey, Gorilla
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Pig FSH beta aa 21-129. (N-terminal His-tag and GST tag; Expressed in E.coli).
    Sequence:

    CELTNITITVEKEECNFCISINTTWCAGYCYTRDLVYKDPARPNIQKTCT FKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDSDSTDCTVRGLGPS YCSFSEMKE


    Database link: P01228

  • Positive control

    • WB: Recombinant pig FSH beta protein; Mouse cerebellum lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

Images

  • Anti-FSH beta antibody (ab231672) at 1 µg/ml + Recombinant pig FSH beta protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 15 kDa

  • Anti-FSH beta antibody (ab231672) at 1 µg/ml + Mouse cerebellum lysate

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 15 kDa

References

ab231672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up