Overview

  • Product name

  • Description

    Rabbit polyclonal to FSP27
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Fusion protein corresponding to Human FSP27 aa 1-238. The identity of the protein fusion partner is GST.
    Sequence:

    MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTA DRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQA LAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKL NPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGH VLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ


    Database link: Q96AQ7

  • Positive control

    • Mouse intestinum tenue and heart tissue lysates; Human liver cancer tissue.
  • General notes

    Previously labelled as CIDE C.

Properties

Applications

Our Abpromise guarantee covers the use of ab198204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 27 kDa.

Target

Images

  • All lanes : Anti-FSP27 antibody (ab198204) at 1/551 dilution

    Lane 1 : Mouse intestinum tenue tissue lysate
    Lane 2 : Mouse heart tissue lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 27 kDa


    Exposure time: 1 minute


    8% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling FSP27 with ab198204 at a 1/50 dilution.

References

ab198204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up