Overview

  • Product name

  • Description

    Rabbit polyclonal to FSP27
  • Host species

    Rabbit
  • Specificity

    Due to the similarity of this protein with CIDEA in Mouse and Rat, there is a chance that this antibody will react with this protein in those two species based on homology.
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human FSP27 aa 110-160 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCL N


    Database link: Q96AQ7

  • Positive control

    • Rat heart, Human colon carcinoma and Mouse stomach tissues.
  • General notes

    Previously labelled as CIDE C.

Properties

Applications

Our Abpromise guarantee covers the use of ab213693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/500.

Target

Images

  • Anti-FSP27 antibody (ab213693) at 1/500 dilution + Mouse epididymis lysates

    Secondary
    Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse stomach tissue labeling FSP27 with ab213693 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling FSP27 with ab213693 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat heart tissue labeling FSP27 with ab213693 at 1/200 dilution, followed by conjugation to a secondary antibody and DAB staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up