Overview

  • Product name

  • Description

    Rabbit polyclonal to FSTL3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Mouse FSTL3 aa 24-256. Mature chain. Expressed in E.coli.
    Sequence:

    VMGSEDSVPGGVCWLQQGREATCSLVLKTRVSREECCASGNINTAWSNFT HPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECVPNC EGLPAGFQVCGSDGATYRDECELRTARCRGHPDLRVMYRGRCQKSCAQVV CPRPQSCLVDQTGSAHCVVCRAAPCPVPSNPGQELCGNNNVTYISSCHLR QATCFLGRSIGVRHPGICTGGPKVPAEEEENFV


    Database link: Q9EQC7

  • Positive control

    • WB: Recombinant mouse FSTL3 protein; Mouse lung tissue lysate. IHC-P: Mouse heart tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 27 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Isoform 1 or the secreted form is a binding and antagonizing protein for members of the TGF-beta family, such us activin, BMP2 and MSTN. Inhibits activin A-, activin B-, BMP2- and MSDT-induced cellular signaling; more effective on activin A than on activin B. Involved in bone formation; inhibits osteoclast differentiationc. Involved in hematopoiesis; involved in differentiation of hemopoietic progenitor cells, increases hematopoietic cell adhesion to fibronectin and seems to contribute to the adhesion of hematopoietic precursor cells to the bone marrow stroma. Isoform 2 or the nuclear form is probably involved in transcriptional regulation via interaction with MLLT10.
  • Tissue specificity

    Expressed in a wide range of tissues.
  • Involvement in disease

    Note=A chromosomal aberration involving FSTL3 is found in a case of B-cell chronic lymphocytic leukemia. Translocation t(11;19)(q13;p13) with CCDN1.
  • Sequence similarities

    Contains 2 follistatin-like domains.
    Contains 2 Kazal-like domains.
    Contains 1 TB (TGF-beta binding) domain.
  • Cellular localization

    Secreted and Nucleus. Although alternative initiation has been demonstrated and resulted in different localization, the major source of nuclear FSTL3 appears not to depend on translation initiation at Met-27 according to.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLRG antibody
    • follistatin-like 3 antibody
    • follistatin-like 3 glycoprotein antibody
    • Follistatin-like protein 3 antibody
    • Follistatin-related gene protein antibody
    • Follistatin-related protein 3 antibody
    • FSRP antibody
    • Fstl3 antibody
    • FSTL3_HUMAN antibody
    see all

Images

  • Anti-FSTL3 antibody (ab232761) at 2 µg/ml + Recombinant mouse FSTL3 protein

    Predicted band size: 27 kDa

  • Anti-FSTL3 antibody (ab232761) at 2 µg/ml + Mouse lung lysate

    Predicted band size: 27 kDa

  • Formalin-fixed, paraffin-embedded mouse heart tissue stained for FSTL3 using ab232761 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232761.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up