Overview

  • Product name

    Anti-FTS antibody
  • Description

    Rabbit polyclonal to FTS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human FTS aa 1-292.
    Sequence:

    MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPI TKPTSPAPAAQSTNGTHASYGPFYLEYSLLAEFTLVVKQKLPGVYVQPSY RSALMWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPL VDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPEAAV LYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAR EKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVAT


    Database link: Q9H8T0

  • Positive control

    • IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human colon cancer tissue stained for FTS using ab238581 at 1/100 dilution in immunohistochemical analysis.

References

ab238581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up