Overview

  • Product name

  • Description

    Rabbit polyclonal to FUCA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey
  • Immunogen

    Synthetic peptide corresponding to Human FUCA1 aa 265-294 conjugated to keyhole limpet haemocyanin.
    Sequence:

    WGQNCSCHHGGYYNCEDKFKPQSLPDHKWE


    Database link: P04066

  • Positive control

    • IHC-P: Human kidney tissue. WB: HepG2 cell lysate. Flow: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Flow Cyt 1/10 - 1/50.

Target

  • Function

    Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
  • Involvement in disease

    Defects in FUCA1 are the cause of fucosidosis (FUCA1D) [MIM:230000]. FUCA1D is an autosomal recessive lysosomal storage disease characterized by accumulation of fucose-containing glycolipids and glycoproteins in various tissues. Clinical signs include facial dysmorphism, dysostosis multiplex, moderate hepatomegaly, severe intellectual deficit, deafness, and according to age, angiokeratomas.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 29 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha L fucosidase I antibody
    • Alpha L fucoside fucohydrolase antibody
    • Alpha-L-fucosidase 1 antibody
    • Alpha-L-fucosidase I antibody
    • Alpha-L-fucoside fucohydrolase 1 antibody
    • FUCA antibody
    • FUCA1 antibody
    • FUCO_HUMAN antibody
    • fucosidase, alpha-L, tissue antibody
    • fucosidase, alpha-L- 1, tissue antibody
    • Tissue alpha L fucosidase antibody
    • Tissue alpha-L-fucosidase antibody
    see all

Images

  • Anti-FUCA1 antibody (ab230324) at 1/1000 dilution + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate at 35 µg

    Predicted band size: 54 kDa

  • Flow cytometric analysis of HepG2 (human liver hepatocellular carcinoma cell line) cells labeling FUCA1 with ab230324 at 1/10 dilution (green) compared with a negative control (blue).

    FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for FUCA1 using ab230324 (5 µg/ml) in immunohistochemical analysis.

References

ab230324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up